php-docs

Paket-Details
Name php-docs
Version 7.0.1-1
Beschreibung Set of HTML documentation for PHP.
URL http://www.php.net/docs.php
Lizenzen PHP
Paket-Details
Repositorium community
Architektur any
Gruppen
Packer Sergej Pupykin @
Erstellt am 04.01.2016 15:28
Veröffentlicht am 04.01.2016 15:29
Quelltext Quelldateien, Änderungshistorie
Bugs Bug-Tracker
Paket php-docs-7.0.1-1-any.pkg.tar.xz
MD5-Prüfsumme 4baf76850983d9fde1a9061ad764bb81
SHA256-Prüfsumme 8d11c613f9ecf4f5ef2a0cd78c6bd02679c40912659ca5e2f307bbfa73c82034
PGP-Signatur php-docs-7.0.1-1-any.pkg.tar.xz.sig
Paket-Größe 7,82 MByte
Installations-Größe 77,09 MByte
Abhängigkeiten
hängt ab von benötigt von stellt bereit kollidiert mit ersetzt
            hängt optional ab von optional benötigt von Bauen hängt ab von Bauen benötigt von Test hängt ab von
                      Dateien
                      • usr
                        • share
                          • doc
                            • php
                              • php-chunked-xhtml
                                • about.formats.html
                                • about.generate.html
                                • about.howtohelp.html
                                • about.html
                                • about.more.html
                                • about.notes.html
                                • about.phpversions.html
                                • about.prototypes.html
                                • about.translations.html
                                • aliases.html
                                • apache.configuration.html
                                • apache.constants.html
                                • apache.installation.html
                                • apache.requirements.html
                                • apache.resources.html
                                • apache.setup.html
                                • apc.configuration.html
                                • apc.constants.html
                                • apc.installation.html
                                • apc.requirements.html
                                • apc.resources.html
                                • apc.setup.html
                                • apciterator.construct.html
                                • apciterator.current.html
                                • apciterator.gettotalcount.html
                                • apciterator.gettotalhits.html
                                • apciterator.gettotalsize.html
                                • apciterator.key.html
                                • apciterator.next.html
                                • apciterator.rewind.html
                                • apciterator.valid.html
                                • apcu.configuration.html
                                • apcu.constants.html
                                • apcu.installation.html
                                • apcu.requirements.html
                                • apcu.resources.html
                                • apcu.setup.html
                                • apcuiterator.construct.html
                                • apcuiterator.current.html
                                • apcuiterator.gettotalcount.html
                                • apcuiterator.gettotalhits.html
                                • apcuiterator.gettotalsize.html
                                • apcuiterator.key.html
                                • apcuiterator.next.html
                                • apcuiterator.rewind.html
                                • apcuiterator.valid.html
                                • apd.configuration.html
                                • apd.constants.html
                                • apd.examples.html
                                • apd.examples.usage.html
                                • apd.installation.html
                                • apd.installwin32.html
                                • apd.requirements.html
                                • apd.resources.html
                                • apd.setup.html
                                • appendices.html
                                • appenditerator.append.html
                                • appenditerator.construct.html
                                • appenditerator.current.html
                                • appenditerator.getarrayiterator.html
                                • appenditerator.getinneriterator.html
                                • appenditerator.getiteratorindex.html
                                • appenditerator.key.html
                                • appenditerator.next.html
                                • appenditerator.rewind.html
                                • appenditerator.valid.html
                                • array.configuration.html
                                • array.constants.html
                                • array.installation.html
                                • array.requirements.html
                                • array.resources.html
                                • array.setup.html
                                • array.sorting.html
                                • arrayaccess.offsetexists.html
                                • arrayaccess.offsetget.html
                                • arrayaccess.offsetset.html
                                • arrayaccess.offsetunset.html
                                • arrayiterator.append.html
                                • arrayiterator.asort.html
                                • arrayiterator.construct.html
                                • arrayiterator.count.html
                                • arrayiterator.current.html
                                • arrayiterator.getarraycopy.html
                                • arrayiterator.getflags.html
                                • arrayiterator.key.html
                                • arrayiterator.ksort.html
                                • arrayiterator.natcasesort.html
                                • arrayiterator.natsort.html
                                • arrayiterator.next.html
                                • arrayiterator.offsetexists.html
                                • arrayiterator.offsetget.html
                                • arrayiterator.offsetset.html
                                • arrayiterator.offsetunset.html
                                • arrayiterator.rewind.html
                                • arrayiterator.seek.html
                                • arrayiterator.serialize.html
                                • arrayiterator.setflags.html
                                • arrayiterator.uasort.html
                                • arrayiterator.uksort.html
                                • arrayiterator.unserialize.html
                                • arrayiterator.valid.html
                                • arrayobject.append.html
                                • arrayobject.asort.html
                                • arrayobject.construct.html
                                • arrayobject.count.html
                                • arrayobject.exchangearray.html
                                • arrayobject.getarraycopy.html
                                • arrayobject.getflags.html
                                • arrayobject.getiterator.html
                                • arrayobject.getiteratorclass.html
                                • arrayobject.ksort.html
                                • arrayobject.natcasesort.html
                                • arrayobject.natsort.html
                                • arrayobject.offsetexists.html
                                • arrayobject.offsetget.html
                                • arrayobject.offsetset.html
                                • arrayobject.offsetunset.html
                                • arrayobject.serialize.html
                                • arrayobject.setflags.html
                                • arrayobject.setiteratorclass.html
                                • arrayobject.uasort.html
                                • arrayobject.uksort.html
                                • arrayobject.unserialize.html
                                • audioproperties.getbitrate.html
                                • audioproperties.getchannels.html
                                • audioproperties.getlayer.html
                                • audioproperties.getlength.html
                                • audioproperties.getsamplebitrate.html
                                • audioproperties.getversion.html
                                • audioproperties.iscopyrighted.html
                                • audioproperties.isoriginal.html
                                • audioproperties.isprotectionenabled.html
                                • bbcode.configuration.html
                                • bbcode.constants.html
                                • bbcode.installation.html
                                • bbcode.requirements.html
                                • bbcode.resources.html
                                • bbcode.setup.html
                                • bc.configuration.html
                                • bc.constants.html
                                • bc.installation.html
                                • bc.requirements.html
                                • bc.resources.html
                                • bc.setup.html
                                • bcompiler.configuration.html
                                • bcompiler.constants.html
                                • bcompiler.installation.html
                                • bcompiler.requirements.html
                                • bcompiler.resources.html
                                • bcompiler.setup.html
                                • blenc.configuration.html
                                • blenc.constants.html
                                • blenc.installation.html
                                • blenc.requirements.html
                                • blenc.resources.html
                                • blenc.setup.html
                                • book.apache.html
                                • book.apc.html
                                • book.apcu.html
                                • book.apd.html
                                • book.array.html
                                • book.bbcode.html
                                • book.bc.html
                                • book.bcompiler.html
                                • book.blenc.html
                                • book.bson.html
                                • book.bzip2.html
                                • book.cairo.html
                                • book.calendar.html
                                • book.chdb.html
                                • book.classkit.html
                                • book.classobj.html
                                • book.com.html
                                • book.crack.html
                                • book.csprng.html
                                • book.ctype.html
                                • book.cubrid.html
                                • book.curl.html
                                • book.cyrus.html
                                • book.datetime.html
                                • book.dba.html
                                • book.dbase.html
                                • book.dbplus.html
                                • book.dbx.html
                                • book.dio.html
                                • book.dir.html
                                • book.dom.html
                                • book.eio.html
                                • book.enchant.html
                                • book.errorfunc.html
                                • book.ev.html
                                • book.event.html
                                • book.exec.html
                                • book.exif.html
                                • book.expect.html
                                • book.fam.html
                                • book.fann.html
                                • book.fbsql.html
                                • book.fdf.html
                                • book.fileinfo.html
                                • book.filepro.html
                                • book.filesystem.html
                                • book.filter.html
                                • book.fpm.html
                                • book.fribidi.html
                                • book.ftp.html
                                • book.funchand.html
                                • book.gearman.html
                                • book.gender.html
                                • book.geoip.html
                                • book.gettext.html
                                • book.gmagick.html
                                • book.gmp.html
                                • book.gnupg.html
                                • book.gupnp.html
                                • book.haru.html
                                • book.hash.html
                                • book.hrtime.html
                                • book.htscanner.html
                                • book.http.html
                                • book.hwapi.html
                                • book.ibase.html
                                • book.ibm-db2.html
                                • book.iconv.html
                                • book.id3.html
                                • book.ifx.html
                                • book.iisfunc.html
                                • book.image.html
                                • book.imagick.html
                                • book.imap.html
                                • book.inclued.html
                                • book.info.html
                                • book.ingres.html
                                • book.inotify.html
                                • book.intl.html
                                • book.json.html
                                • book.judy.html
                                • book.kadm5.html
                                • book.ktaglib.html
                                • book.lapack.html
                                • book.ldap.html
                                • book.libevent.html
                                • book.libxml.html
                                • book.lua.html
                                • book.lzf.html
                                • book.mail.html
                                • book.mailparse.html
                                • book.math.html
                                • book.maxdb.html
                                • book.mbstring.html
                                • book.mcrypt.html
                                • book.mcve.html
                                • book.memcache.html
                                • book.memcached.html
                                • book.memtrack.html
                                • book.mhash.html
                                • book.mime-magic.html
                                • book.ming.html
                                • book.misc.html
                                • book.mnogosearch.html
                                • book.mongo.html
                                • book.mongodb.html
                                • book.mqseries.html
                                • book.msession.html
                                • book.msql.html
                                • book.mssql.html
                                • book.mysql.html
                                • book.mysqli.html
                                • book.mysqlnd-memcache.html
                                • book.mysqlnd-ms.html
                                • book.mysqlnd-mux.html
                                • book.mysqlnd-qc.html
                                • book.mysqlnd-uh.html
                                • book.mysqlnd.html
                                • book.ncurses.html
                                • book.net-gopher.html
                                • book.network.html
                                • book.newt.html
                                • book.nis.html
                                • book.nsapi.html
                                • book.oauth.html
                                • book.oci8.html
                                • book.oggvorbis.html
                                • book.opcache.html
                                • book.openal.html
                                • book.openssl.html
                                • book.outcontrol.html
                                • book.paradox.html
                                • book.parsekit.html
                                • book.password.html
                                • book.pcntl.html
                                • book.pcre.html
                                • book.pdf.html
                                • book.pdo.html
                                • book.pgsql.html
                                • book.phar.html
                                • book.posix.html
                                • book.proctitle.html
                                • book.ps.html
                                • book.pspell.html
                                • book.pthreads.html
                                • book.quickhash.html
                                • book.radius.html
                                • book.rar.html
                                • book.readline.html
                                • book.recode.html
                                • book.reflection.html
                                • book.regex.html
                                • book.rpmreader.html
                                • book.rrd.html
                                • book.runkit.html
                                • book.sam.html
                                • book.sca.html
                                • book.scream.html
                                • book.sdo-das-xml.html
                                • book.sdo.html
                                • book.sdodasrel.html
                                • book.sem.html
                                • book.session-pgsql.html
                                • book.session.html
                                • book.shmop.html
                                • book.simplexml.html
                                • book.snmp.html
                                • book.soap.html
                                • book.sockets.html
                                • book.solr.html
                                • book.sphinx.html
                                • book.spl-types.html
                                • book.spl.html
                                • book.spplus.html
                                • book.sqlite.html
                                • book.sqlite3.html
                                • book.sqlsrv.html
                                • book.ssdeep.html
                                • book.ssh2.html
                                • book.stats.html
                                • book.stomp.html
                                • book.stream.html
                                • book.strings.html
                                • book.svm.html
                                • book.svn.html
                                • book.swish.html
                                • book.sybase.html
                                • book.sync.html
                                • book.taint.html
                                • book.tcpwrap.html
                                • book.tidy.html
                                • book.tokenizer.html
                                • book.tokyo-tyrant.html
                                • book.trader.html
                                • book.uodbc.html
                                • book.uopz.html
                                • book.url.html
                                • book.v8js.html
                                • book.var.html
                                • book.varnish.html
                                • book.vpopmail.html
                                • book.wddx.html
                                • book.weakref.html
                                • book.win32ps.html
                                • book.win32service.html
                                • book.wincache.html
                                • book.xattr.html
                                • book.xdiff.html
                                • book.xhprof.html
                                • book.xml.html
                                • book.xmldiff.html
                                • book.xmlreader.html
                                • book.xmlrpc.html
                                • book.xmlwriter.html
                                • book.xsl.html
                                • book.yaf.html
                                • book.yaml.html
                                • book.yar.html
                                • book.yaz.html
                                • book.zip.html
                                • book.zlib.html
                                • book.zmq.html
                                • bzip2.configuration.html
                                • bzip2.constants.html
                                • bzip2.examples.html
                                • bzip2.installation.html
                                • bzip2.requirements.html
                                • bzip2.resources.html
                                • bzip2.setup.html
                                • cachingiterator.construct.html
                                • cachingiterator.count.html
                                • cachingiterator.current.html
                                • cachingiterator.getcache.html
                                • cachingiterator.getflags.html
                                • cachingiterator.getinneriterator.html
                                • cachingiterator.hasnext.html
                                • cachingiterator.key.html
                                • cachingiterator.next.html
                                • cachingiterator.offsetexists.html
                                • cachingiterator.offsetget.html
                                • cachingiterator.offsetset.html
                                • cachingiterator.offsetunset.html
                                • cachingiterator.rewind.html
                                • cachingiterator.setflags.html
                                • cachingiterator.tostring.html
                                • cachingiterator.valid.html
                                • cairo.availablefonts.html
                                • cairo.availablesurfaces.html
                                • cairo.configuration.html
                                • cairo.constants.html
                                • cairo.examples.html
                                • cairo.installation.html
                                • cairo.requirements.html
                                • cairo.resources.html
                                • cairo.setup.html
                                • cairo.statustostring.html
                                • cairo.version.html
                                • cairo.versionstring.html
                                • cairocontext.appendpath.html
                                • cairocontext.arc.html
                                • cairocontext.arcnegative.html
                                • cairocontext.clip.html
                                • cairocontext.clipextents.html
                                • cairocontext.clippreserve.html
                                • cairocontext.cliprectanglelist.html
                                • cairocontext.closepath.html
                                • cairocontext.construct.html
                                • cairocontext.copypage.html
                                • cairocontext.copypath.html
                                • cairocontext.copypathflat.html
                                • cairocontext.curveto.html
                                • cairocontext.devicetouser.html
                                • cairocontext.devicetouserdistance.html
                                • cairocontext.fill.html
                                • cairocontext.fillextents.html
                                • cairocontext.fillpreserve.html
                                • cairocontext.fontextents.html
                                • cairocontext.getantialias.html
                                • cairocontext.getcurrentpoint.html
                                • cairocontext.getdash.html
                                • cairocontext.getdashcount.html
                                • cairocontext.getfillrule.html
                                • cairocontext.getfontface.html
                                • cairocontext.getfontmatrix.html
                                • cairocontext.getfontoptions.html
                                • cairocontext.getgrouptarget.html
                                • cairocontext.getlinecap.html
                                • cairocontext.getlinejoin.html
                                • cairocontext.getlinewidth.html
                                • cairocontext.getmatrix.html
                                • cairocontext.getmiterlimit.html
                                • cairocontext.getoperator.html
                                • cairocontext.getscaledfont.html
                                • cairocontext.getsource.html
                                • cairocontext.gettarget.html
                                • cairocontext.gettolerance.html
                                • cairocontext.glyphpath.html
                                • cairocontext.hascurrentpoint.html
                                • cairocontext.identitymatrix.html
                                • cairocontext.infill.html
                                • cairocontext.instroke.html
                                • cairocontext.lineto.html
                                • cairocontext.mask.html
                                • cairocontext.masksurface.html
                                • cairocontext.moveto.html
                                • cairocontext.newpath.html
                                • cairocontext.newsubpath.html
                                • cairocontext.paint.html
                                • cairocontext.paintwithalpha.html
                                • cairocontext.pathextents.html
                                • cairocontext.popgroup.html
                                • cairocontext.popgrouptosource.html
                                • cairocontext.pushgroup.html
                                • cairocontext.pushgroupwithcontent.html
                                • cairocontext.rectangle.html
                                • cairocontext.relcurveto.html
                                • cairocontext.rellineto.html
                                • cairocontext.relmoveto.html
                                • cairocontext.resetclip.html
                                • cairocontext.restore.html
                                • cairocontext.rotate.html
                                • cairocontext.save.html
                                • cairocontext.scale.html
                                • cairocontext.selectfontface.html
                                • cairocontext.setantialias.html
                                • cairocontext.setdash.html
                                • cairocontext.setfillrule.html
                                • cairocontext.setfontface.html
                                • cairocontext.setfontmatrix.html
                                • cairocontext.setfontoptions.html
                                • cairocontext.setfontsize.html
                                • cairocontext.setlinecap.html
                                • cairocontext.setlinejoin.html
                                • cairocontext.setlinewidth.html
                                • cairocontext.setmatrix.html
                                • cairocontext.setmiterlimit.html
                                • cairocontext.setoperator.html
                                • cairocontext.setscaledfont.html
                                • cairocontext.setsource.html
                                • cairocontext.setsourcergb.html
                                • cairocontext.setsourcergba.html
                                • cairocontext.setsourcesurface.html
                                • cairocontext.settolerance.html
                                • cairocontext.showpage.html
                                • cairocontext.showtext.html
                                • cairocontext.status.html
                                • cairocontext.stroke.html
                                • cairocontext.strokeextents.html
                                • cairocontext.strokepreserve.html
                                • cairocontext.textextents.html
                                • cairocontext.textpath.html
                                • cairocontext.transform.html
                                • cairocontext.translate.html
                                • cairocontext.usertodevice.html
                                • cairocontext.usertodevicedistance.html
                                • cairofontface.construct.html
                                • cairofontface.gettype.html
                                • cairofontface.status.html
                                • cairofontoptions.construct.html
                                • cairofontoptions.equal.html
                                • cairofontoptions.getantialias.html
                                • cairofontoptions.gethintmetrics.html
                                • cairofontoptions.gethintstyle.html
                                • cairofontoptions.getsubpixelorder.html
                                • cairofontoptions.hash.html
                                • cairofontoptions.merge.html
                                • cairofontoptions.setantialias.html
                                • cairofontoptions.sethintmetrics.html
                                • cairofontoptions.sethintstyle.html
                                • cairofontoptions.setsubpixelorder.html
                                • cairofontoptions.status.html
                                • cairoformat.strideforwidth.html
                                • cairogradientpattern.addcolorstoprgb.html
                                • cairogradientpattern.addcolorstoprgba.html
                                • cairogradientpattern.getcolorstopcount.html
                                • cairogradientpattern.getcolorstoprgba.html
                                • cairogradientpattern.getextend.html
                                • cairogradientpattern.setextend.html
                                • cairoimagesurface.construct.html
                                • cairoimagesurface.createfordata.html
                                • cairoimagesurface.createfrompng.html
                                • cairoimagesurface.getdata.html
                                • cairoimagesurface.getformat.html
                                • cairoimagesurface.getheight.html
                                • cairoimagesurface.getstride.html
                                • cairoimagesurface.getwidth.html
                                • cairolineargradient.construct.html
                                • cairolineargradient.getpoints.html
                                • cairomatrix.construct.html
                                • cairomatrix.initidentity.html
                                • cairomatrix.initrotate.html
                                • cairomatrix.initscale.html
                                • cairomatrix.inittranslate.html
                                • cairomatrix.invert.html
                                • cairomatrix.multiply.html
                                • cairomatrix.rotate.html
                                • cairomatrix.scale.html
                                • cairomatrix.transformdistance.html
                                • cairomatrix.transformpoint.html
                                • cairomatrix.translate.html
                                • cairopattern.construct.html
                                • cairopattern.getmatrix.html
                                • cairopattern.gettype.html
                                • cairopattern.setmatrix.html
                                • cairopattern.status.html
                                • cairopdfsurface.construct.html
                                • cairopdfsurface.setsize.html
                                • cairopssurface.construct.html
                                • cairopssurface.dscbeginpagesetup.html
                                • cairopssurface.dscbeginsetup.html
                                • cairopssurface.dsccomment.html
                                • cairopssurface.geteps.html
                                • cairopssurface.getlevels.html
                                • cairopssurface.leveltostring.html
                                • cairopssurface.restricttolevel.html
                                • cairopssurface.seteps.html
                                • cairopssurface.setsize.html
                                • cairoradialgradient.construct.html
                                • cairoradialgradient.getcircles.html
                                • cairoscaledfont.construct.html
                                • cairoscaledfont.extents.html
                                • cairoscaledfont.getctm.html
                                • cairoscaledfont.getfontface.html
                                • cairoscaledfont.getfontmatrix.html
                                • cairoscaledfont.getfontoptions.html
                                • cairoscaledfont.getscalematrix.html
                                • cairoscaledfont.gettype.html
                                • cairoscaledfont.glyphextents.html
                                • cairoscaledfont.status.html
                                • cairoscaledfont.textextents.html
                                • cairosolidpattern.construct.html
                                • cairosolidpattern.getrgba.html
                                • cairosurface.construct.html
                                • cairosurface.copypage.html
                                • cairosurface.createsimilar.html
                                • cairosurface.finish.html
                                • cairosurface.flush.html
                                • cairosurface.getcontent.html
                                • cairosurface.getdeviceoffset.html
                                • cairosurface.getfontoptions.html
                                • cairosurface.gettype.html
                                • cairosurface.markdirty.html
                                • cairosurface.markdirtyrectangle.html
                                • cairosurface.setdeviceoffset.html
                                • cairosurface.setfallbackresolution.html
                                • cairosurface.showpage.html
                                • cairosurface.status.html
                                • cairosurface.writetopng.html
                                • cairosurfacepattern.construct.html
                                • cairosurfacepattern.getextend.html
                                • cairosurfacepattern.getfilter.html
                                • cairosurfacepattern.getsurface.html
                                • cairosurfacepattern.setextend.html
                                • cairosurfacepattern.setfilter.html
                                • cairosvgsurface.construct.html
                                • cairosvgsurface.getversions.html
                                • cairosvgsurface.restricttoversion.html
                                • cairosvgsurface.versiontostring.html
                                • calendar.configuration.html
                                • calendar.constants.html
                                • calendar.installation.html
                                • calendar.requirements.html
                                • calendar.resources.html
                                • calendar.setup.html
                                • callbackfilteriterator.accept.html
                                • callbackfilteriterator.construct.html
                                • cc.license.html
                                • changelog.misc.html
                                • changelog.mongo.html
                                • changelog.mysql.html
                                • changelog.mysqli.html
                                • changelog.strings.html
                                • chdb.configuration.html
                                • chdb.constants.html
                                • chdb.construct.html
                                • chdb.examples.html
                                • chdb.get.html
                                • chdb.installation.html
                                • chdb.requirements.html
                                • chdb.resources.html
                                • chdb.setup.html
                                • class.apciterator.html
                                • class.apcuiterator.html
                                • class.appenditerator.html
                                • class.arithmeticerror.html
                                • class.arrayaccess.html
                                • class.arrayiterator.html
                                • class.arrayobject.html
                                • class.assertionerror.html
                                • class.badfunctioncallexception.html
                                • class.badmethodcallexception.html
                                • class.cachingiterator.html
                                • class.cairo.html
                                • class.cairoantialias.html
                                • class.cairocontent.html
                                • class.cairocontext.html
                                • class.cairoexception.html
                                • class.cairoextend.html
                                • class.cairofillrule.html
                                • class.cairofilter.html
                                • class.cairofontface.html
                                • class.cairofontoptions.html
                                • class.cairofontslant.html
                                • class.cairofonttype.html
                                • class.cairofontweight.html
                                • class.cairoformat.html
                                • class.cairogradientpattern.html
                                • class.cairohintmetrics.html
                                • class.cairohintstyle.html
                                • class.cairoimagesurface.html
                                • class.cairolineargradient.html
                                • class.cairolinecap.html
                                • class.cairolinejoin.html
                                • class.cairomatrix.html
                                • class.cairooperator.html
                                • class.cairopath.html
                                • class.cairopattern.html
                                • class.cairopatterntype.html
                                • class.cairopdfsurface.html
                                • class.cairopslevel.html
                                • class.cairopssurface.html
                                • class.cairoradialgradient.html
                                • class.cairoscaledfont.html
                                • class.cairosolidpattern.html
                                • class.cairostatus.html
                                • class.cairosubpixelorder.html
                                • class.cairosurface.html
                                • class.cairosurfacepattern.html
                                • class.cairosurfacetype.html
                                • class.cairosvgsurface.html
                                • class.cairosvgversion.html
                                • class.cairotoyfontface.html
                                • class.callbackfilteriterator.html
                                • class.chdb.html
                                • class.closure.html
                                • class.collator.html
                                • class.collectable.html
                                • class.com.html
                                • class.cond.html
                                • class.countable.html
                                • class.curlfile.html
                                • class.dateinterval.html
                                • class.dateperiod.html
                                • class.datetime.html
                                • class.datetimeimmutable.html
                                • class.datetimeinterface.html
                                • class.datetimezone.html
                                • class.directory.html
                                • class.directoryiterator.html
                                • class.divisionbyzeroerror.html
                                • class.domainexception.html
                                • class.domattr.html
                                • class.domcdatasection.html
                                • class.domcharacterdata.html
                                • class.domcomment.html
                                • class.domdocument.html
                                • class.domdocumentfragment.html
                                • class.domdocumenttype.html
                                • class.domelement.html
                                • class.domentity.html
                                • class.domentityreference.html
                                • class.domexception.html
                                • class.domimplementation.html
                                • class.domnamednodemap.html
                                • class.domnode.html
                                • class.domnodelist.html
                                • class.domnotation.html
                                • class.domprocessinginstruction.html
                                • class.domtext.html
                                • class.domxpath.html
                                • class.dotnet.html
                                • class.emptyiterator.html
                                • class.error.html
                                • class.errorexception.html
                                • class.ev.html
                                • class.evcheck.html
                                • class.evchild.html
                                • class.evembed.html
                                • class.event.html
                                • class.eventbase.html
                                • class.eventbuffer.html
                                • class.eventbufferevent.html
                                • class.eventconfig.html
                                • class.eventdnsbase.html
                                • class.eventhttp.html
                                • class.eventhttpconnection.html
                                • class.eventhttprequest.html
                                • class.eventlistener.html
                                • class.eventsslcontext.html
                                • class.eventutil.html
                                • class.evfork.html
                                • class.evidle.html
                                • class.evio.html
                                • class.evloop.html
                                • class.evperiodic.html
                                • class.evprepare.html
                                • class.evsignal.html
                                • class.evstat.html
                                • class.evtimer.html
                                • class.evwatcher.html
                                • class.exception.html
                                • class.fannconnection.html
                                • class.filesystemiterator.html
                                • class.filteriterator.html
                                • class.finfo.html
                                • class.gearmanclient.html
                                • class.gearmanexception.html
                                • class.gearmanjob.html
                                • class.gearmantask.html
                                • class.gearmanworker.html
                                • class.gender.html
                                • class.generator.html
                                • class.globiterator.html
                                • class.gmagick.html
                                • class.gmagickdraw.html
                                • class.gmagickpixel.html
                                • class.gmp.html
                                • class.haruannotation.html
                                • class.harudestination.html
                                • class.harudoc.html
                                • class.haruencoder.html
                                • class.haruexception.html
                                • class.harufont.html
                                • class.haruimage.html
                                • class.haruoutline.html
                                • class.harupage.html
                                • class.hrtime-performancecounter.html
                                • class.hrtime-stopwatch.html
                                • class.hrtime-unit.html
                                • class.httpdeflatestream.html
                                • class.httpinflatestream.html
                                • class.httpmessage.html
                                • class.httpquerystring.html
                                • class.httprequest.html
                                • class.httprequestpool.html
                                • class.httpresponse.html
                                • class.imagick.html
                                • class.imagickdraw.html
                                • class.imagickkernel.html
                                • class.imagickpixel.html
                                • class.imagickpixeliterator.html
                                • class.infiniteiterator.html
                                • class.intlbreakiterator.html
                                • class.intlcalendar.html
                                • class.intlchar.html
                                • class.intlcodepointbreakiterator.html
                                • class.intldateformatter.html
                                • class.intlexception.html
                                • class.intliterator.html
                                • class.intlpartsiterator.html
                                • class.intlrulebasedbreakiterator.html
                                • class.intltimezone.html
                                • class.invalidargumentexception.html
                                • class.iterator.html
                                • class.iteratoraggregate.html
                                • class.iteratoriterator.html
                                • class.jsonserializable.html
                                • class.judy.html
                                • class.ktaglib-id3v2-attachedpictureframe.html
                                • class.ktaglib-id3v2-frame.html
                                • class.ktaglib-id3v2-tag.html
                                • class.ktaglib-mpeg-audioproperties.html
                                • class.ktaglib-mpeg-file.html
                                • class.ktaglib-tag.html
                                • class.lapack.html
                                • class.lapackexception.html
                                • class.lengthexception.html
                                • class.libxmlerror.html
                                • class.limititerator.html
                                • class.locale.html
                                • class.logicexception.html
                                • class.lua.html
                                • class.luaclosure.html
                                • class.memcache.html
                                • class.memcached.html
                                • class.memcachedexception.html
                                • class.messageformatter.html
                                • class.mongo.html
                                • class.mongobindata.html
                                • class.mongoclient.html
                                • class.mongocode.html
                                • class.mongocollection.html
                                • class.mongocommandcursor.html
                                • class.mongoconnectionexception.html
                                • class.mongocursor.html
                                • class.mongocursorexception.html
                                • class.mongocursorinterface.html
                                • class.mongocursortimeoutexception.html
                                • class.mongodate.html
                                • class.mongodb-bson-binary.html
                                • class.mongodb-bson-javascript.html
                                • class.mongodb-bson-maxkey.html
                                • class.mongodb-bson-minkey.html
                                • class.mongodb-bson-objectid.html
                                • class.mongodb-bson-persistable.html
                                • class.mongodb-bson-regex.html
                                • class.mongodb-bson-serializable.html
                                • class.mongodb-bson-timestamp.html
                                • class.mongodb-bson-type.html
                                • class.mongodb-bson-unserializable.html
                                • class.mongodb-bson-utcdatetime.html
                                • class.mongodb-driver-bulkwrite.html
                                • class.mongodb-driver-command.html
                                • class.mongodb-driver-cursor.html
                                • class.mongodb-driver-cursorid.html
                                • class.mongodb-driver-exception-authenticationexception.html
                                • class.mongodb-driver-exception-bulkwriteexception.html
                                • class.mongodb-driver-exception-connectionexception.html
                                • class.mongodb-driver-exception-connectiontimeoutexception.html
                                • class.mongodb-driver-exception-exception.html
                                • class.mongodb-driver-exception-executiontimeoutexception.html
                                • class.mongodb-driver-exception-invalidargumentexception.html
                                • class.mongodb-driver-exception-logicexception.html
                                • class.mongodb-driver-exception-runtimeexception.html
                                • class.mongodb-driver-exception-sslconnectionexception.html
                                • class.mongodb-driver-exception-unexpectedvalueexception.html
                                • class.mongodb-driver-exception-writeexception.html
                                • class.mongodb-driver-manager.html
                                • class.mongodb-driver-query.html
                                • class.mongodb-driver-readconcern.html
                                • class.mongodb-driver-readpreference.html
                                • class.mongodb-driver-server.html
                                • class.mongodb-driver-writeconcern.html
                                • class.mongodb-driver-writeconcernerror.html
                                • class.mongodb-driver-writeerror.html
                                • class.mongodb-driver-writeresult.html
                                • class.mongodb.html
                                • class.mongodbref.html
                                • class.mongodeletebatch.html
                                • class.mongoduplicatekeyexception.html
                                • class.mongoexception.html
                                • class.mongoexecutiontimeoutexception.html
                                • class.mongogridfs.html
                                • class.mongogridfscursor.html
                                • class.mongogridfsexception.html
                                • class.mongogridfsfile.html
                                • class.mongoid.html
                                • class.mongoinsertbatch.html
                                • class.mongoint32.html
                                • class.mongoint64.html
                                • class.mongolog.html
                                • class.mongomaxkey.html
                                • class.mongominkey.html
                                • class.mongopool.html
                                • class.mongoprotocolexception.html
                                • class.mongoregex.html
                                • class.mongoresultexception.html
                                • class.mongotimestamp.html
                                • class.mongoupdatebatch.html
                                • class.mongowritebatch.html
                                • class.mongowriteconcernexception.html
                                • class.multipleiterator.html
                                • class.mutex.html
                                • class.mysqli-driver.html
                                • class.mysqli-result.html
                                • class.mysqli-sql-exception.html
                                • class.mysqli-stmt.html
                                • class.mysqli-warning.html
                                • class.mysqli.html
                                • class.mysqlnduhconnection.html
                                • class.mysqlnduhpreparedstatement.html
                                • class.norewinditerator.html
                                • class.normalizer.html
                                • class.numberformatter.html
                                • class.oauth.html
                                • class.oauthexception.html
                                • class.oauthprovider.html
                                • class.OCI-Collection.html
                                • class.OCI-Lob.html
                                • class.outeriterator.html
                                • class.outofboundsexception.html
                                • class.outofrangeexception.html
                                • class.overflowexception.html
                                • class.parentiterator.html
                                • class.parseerror.html
                                • class.pdo.html
                                • class.pdoexception.html
                                • class.pdostatement.html
                                • class.phar.html
                                • class.phardata.html
                                • class.pharexception.html
                                • class.pharfileinfo.html
                                • class.php-user-filter.html
                                • class.pool.html
                                • class.quickhashinthash.html
                                • class.quickhashintset.html
                                • class.quickhashintstringhash.html
                                • class.quickhashstringinthash.html
                                • class.rangeexception.html
                                • class.rararchive.html
                                • class.rarentry.html
                                • class.rarexception.html
                                • class.recursivearrayiterator.html
                                • class.recursivecachingiterator.html
                                • class.recursivecallbackfilteriterator.html
                                • class.recursivedirectoryiterator.html
                                • class.recursivefilteriterator.html
                                • class.recursiveiterator.html
                                • class.recursiveiteratoriterator.html
                                • class.recursiveregexiterator.html
                                • class.recursivetreeiterator.html
                                • class.reflection.html
                                • class.reflectionclass.html
                                • class.reflectionexception.html
                                • class.reflectionextension.html
                                • class.reflectionfunction.html
                                • class.reflectionfunctionabstract.html
                                • class.reflectiongenerator.html
                                • class.reflectionmethod.html
                                • class.reflectionobject.html
                                • class.reflectionparameter.html
                                • class.reflectionproperty.html
                                • class.reflectiontype.html
                                • class.reflectionzendextension.html
                                • class.reflector.html
                                • class.regexiterator.html
                                • class.resourcebundle.html
                                • class.rrdcreator.html
                                • class.rrdgraph.html
                                • class.rrdupdater.html
                                • class.runtimeexception.html
                                • class.seekableiterator.html
                                • class.serializable.html
                                • class.sessionhandler.html
                                • class.sessionhandlerinterface.html
                                • class.simplexmlelement.html
                                • class.simplexmliterator.html
                                • class.snmp.html
                                • class.snmpexception.html
                                • class.soapclient.html
                                • class.soapfault.html
                                • class.soapheader.html
                                • class.soapparam.html
                                • class.soapserver.html
                                • class.soapvar.html
                                • class.solrclient.html
                                • class.solrclientexception.html
                                • class.solrcollapsefunction.html
                                • class.solrdismaxquery.html
                                • class.solrdocument.html
                                • class.solrdocumentfield.html
                                • class.solrexception.html
                                • class.solrgenericresponse.html
                                • class.solrillegalargumentexception.html
                                • class.solrillegaloperationexception.html
                                • class.solrinputdocument.html
                                • class.solrmissingmandatoryparameterexception.html
                                • class.solrmodifiableparams.html
                                • class.solrobject.html
                                • class.solrparams.html
                                • class.solrpingresponse.html
                                • class.solrquery.html
                                • class.solrqueryresponse.html
                                • class.solrresponse.html
                                • class.solrserverexception.html
                                • class.solrupdateresponse.html
                                • class.solrutils.html
                                • class.sphinxclient.html
                                • class.splbool.html
                                • class.spldoublylinkedlist.html
                                • class.splenum.html
                                • class.splfileinfo.html
                                • class.splfileobject.html
                                • class.splfixedarray.html
                                • class.splfloat.html
                                • class.splheap.html
                                • class.splint.html
                                • class.splmaxheap.html
                                • class.splminheap.html
                                • class.splobjectstorage.html
                                • class.splobserver.html
                                • class.splpriorityqueue.html
                                • class.splqueue.html
                                • class.splstack.html
                                • class.splstring.html
                                • class.splsubject.html
                                • class.spltempfileobject.html
                                • class.spltype.html
                                • class.spoofchecker.html
                                • class.sqlite3.html
                                • class.sqlite3result.html
                                • class.sqlite3stmt.html
                                • class.stomp.html
                                • class.stompexception.html
                                • class.stompframe.html
                                • class.streamwrapper.html
                                • class.svm.html
                                • class.svmmodel.html
                                • class.swfaction.html
                                • class.swfbitmap.html
                                • class.swfbutton.html
                                • class.swfdisplayitem.html
                                • class.swffill.html
                                • class.swffont.html
                                • class.swffontchar.html
                                • class.swfgradient.html
                                • class.swfmorph.html
                                • class.swfmovie.html
                                • class.swfprebuiltclip.html
                                • class.swfshape.html
                                • class.swfsound.html
                                • class.swfsoundinstance.html
                                • class.swfsprite.html
                                • class.swftext.html
                                • class.swftextfield.html
                                • class.swfvideostream.html
                                • class.syncevent.html
                                • class.syncmutex.html
                                • class.syncreaderwriter.html
                                • class.syncsemaphore.html
                                • class.thread.html
                                • class.threaded.html
                                • class.throwable.html
                                • class.tidy.html
                                • class.tidynode.html
                                • class.tokyotyrant.html
                                • class.tokyotyrantexception.html
                                • class.tokyotyrantiterator.html
                                • class.tokyotyrantquery.html
                                • class.tokyotyranttable.html
                                • class.transliterator.html
                                • class.traversable.html
                                • class.typeerror.html
                                • class.uconverter.html
                                • class.underflowexception.html
                                • class.unexpectedvalueexception.html
                                • class.v8js.html
                                • class.v8jsexception.html
                                • class.variant.html
                                • class.varnishadmin.html
                                • class.varnishlog.html
                                • class.varnishstat.html
                                • class.weakmap.html
                                • class.weakref.html
                                • class.worker.html
                                • class.xmldiff-base.html
                                • class.xmldiff-dom.html
                                • class.xmldiff-file.html
                                • class.xmldiff-memory.html
                                • class.xmlreader.html
                                • class.xsltprocessor.html
                                • class.yaf-action-abstract.html
                                • class.yaf-application.html
                                • class.yaf-bootstrap-abstract.html
                                • class.yaf-config-abstract.html
                                • class.yaf-config-ini.html
                                • class.yaf-config-simple.html
                                • class.yaf-controller-abstract.html
                                • class.yaf-dispatcher.html
                                • class.yaf-exception-dispatchfailed.html
                                • class.yaf-exception-loadfailed-action.html
                                • class.yaf-exception-loadfailed-controller.html
                                • class.yaf-exception-loadfailed-module.html
                                • class.yaf-exception-loadfailed-view.html
                                • class.yaf-exception-loadfailed.html
                                • class.yaf-exception-routerfailed.html
                                • class.yaf-exception-startuperror.html
                                • class.yaf-exception-typeerror.html
                                • class.yaf-exception.html
                                • class.yaf-loader.html
                                • class.yaf-plugin-abstract.html
                                • class.yaf-registry.html
                                • class.yaf-request-abstract.html
                                • class.yaf-request-http.html
                                • class.yaf-request-simple.html
                                • class.yaf-response-abstract.html
                                • class.yaf-route-interface.html
                                • class.yaf-route-map.html
                                • class.yaf-route-regex.html
                                • class.yaf-route-rewrite.html
                                • class.yaf-route-simple.html
                                • class.yaf-route-static.html
                                • class.yaf-route-supervar.html
                                • class.yaf-router.html
                                • class.yaf-session.html
                                • class.yaf-view-interface.html
                                • class.yaf-view-simple.html
                                • class.yar-client-exception.html
                                • class.yar-client.html
                                • class.yar-concurrent-client.html
                                • class.yar-server-exception.html
                                • class.yar-server.html
                                • class.ziparchive.html
                                • class.zmq.html
                                • class.zmqcontext.html
                                • class.zmqdevice.html
                                • class.zmqpoll.html
                                • class.zmqsocket.html
                                • classkit.configuration.html
                                • classkit.constants.html
                                • classkit.installation.html
                                • classkit.requirements.html
                                • classkit.resources.html
                                • classkit.setup.html
                                • classobj.configuration.html
                                • classobj.constants.html
                                • classobj.examples.html
                                • classobj.installation.html
                                • classobj.requirements.html
                                • classobj.resources.html
                                • classobj.setup.html
                                • closure.bind.html
                                • closure.bindto.html
                                • closure.call.html
                                • closure.construct.html
                                • collator.asort.html
                                • collator.compare.html
                                • collator.construct.html
                                • collator.create.html
                                • collator.getattribute.html
                                • collator.geterrorcode.html
                                • collator.geterrormessage.html
                                • collator.getlocale.html
                                • collator.getsortkey.html
                                • collator.getstrength.html
                                • collator.setattribute.html
                                • collator.setstrength.html
                                • collator.sort.html
                                • collator.sortwithsortkeys.html
                                • collectable.isgarbage.html
                                • collectable.setgarbage.html
                                • com.configuration.html
                                • com.constants.html
                                • com.error-handling.html
                                • com.examples.arrays.html
                                • com.examples.foreach.html
                                • com.examples.html
                                • com.installation.html
                                • com.requirements.html
                                • com.resources.html
                                • com.setup.html
                                • cond.broadcast.html
                                • cond.create.html
                                • cond.destroy.html
                                • cond.signal.html
                                • cond.wait.html
                                • configuration.changes.html
                                • configuration.changes.modes.html
                                • configuration.file.html
                                • configuration.file.per-user.html
                                • configuration.html
                                • configure.about.html
                                • configure.html
                                • constants.dbx.html
                                • constants.newt.anchor.html
                                • constants.newt.args-flags.html
                                • constants.newt.cbtree-flags.html
                                • constants.newt.colorsets.html
                                • constants.newt.components-flags.html
                                • constants.newt.entry-flags.html
                                • constants.newt.fd-flags.html
                                • constants.newt.form-flags.html
                                • constants.newt.grid-flags.html
                                • constants.newt.keys.html
                                • constants.newt.listbox-flags.html
                                • constants.newt.reasons.html
                                • constants.newt.sense-flags.html
                                • constants.newt.textbox-flags.html
                                • context.curl.html
                                • context.ftp.html
                                • context.html
                                • context.http.html
                                • context.mongodb.html
                                • context.params.html
                                • context.phar.html
                                • context.socket.html
                                • context.ssl.html
                                • control-structures.alternative-syntax.html
                                • control-structures.break.html
                                • control-structures.continue.html
                                • control-structures.declare.html
                                • control-structures.do.while.html
                                • control-structures.else.html
                                • control-structures.elseif.html
                                • control-structures.for.html
                                • control-structures.foreach.html
                                • control-structures.goto.html
                                • control-structures.if.html
                                • control-structures.intro.html
                                • control-structures.switch.html
                                • control-structures.while.html
                                • copyright.html
                                • countable.count.html
                                • crack.configuration.html
                                • crack.constants.html
                                • crack.examples.html
                                • crack.installation.html
                                • crack.requirements.html
                                • crack.resources.html
                                • crack.setup.html
                                • csprng.configuration.html
                                • csprng.constants.html
                                • csprng.installation.html
                                • csprng.requirements.html
                                • csprng.resources.html
                                • csprng.setup.html
                                • ctype.configuration.html
                                • ctype.constants.html
                                • ctype.installation.html
                                • ctype.requirements.html
                                • ctype.resources.html
                                • ctype.setup.html
                                • cubrid.configuration.html
                                • cubrid.constants.html
                                • cubrid.examples.html
                                • cubrid.installation.html
                                • cubrid.requirements.html
                                • cubrid.resources.html
                                • cubrid.setup.html
                                • cubridmysql.cubrid.html
                                • curl.configuration.html
                                • curl.constants.html
                                • curl.examples-basic.html
                                • curl.examples.html
                                • curl.installation.html
                                • curl.requirements.html
                                • curl.resources.html
                                • curl.setup.html
                                • curlfile.construct.html
                                • curlfile.getfilename.html
                                • curlfile.getmimetype.html
                                • curlfile.getpostfilename.html
                                • curlfile.setmimetype.html
                                • curlfile.setpostfilename.html
                                • curlfile.wakeup.html
                                • cyrus.configuration.html
                                • cyrus.constants.html
                                • cyrus.installation.html
                                • cyrus.requirements.html
                                • cyrus.resources.html
                                • cyrus.setup.html
                                • dateinterval.construct.html
                                • dateinterval.createfromdatestring.html
                                • dateinterval.format.html
                                • dateperiod.construct.html
                                • datetime.add.html
                                • datetime.configuration.html
                                • datetime.constants.html
                                • datetime.construct.html
                                • datetime.createfromformat.html
                                • datetime.diff.html
                                • datetime.format.html
                                • datetime.formats.compound.html
                                • datetime.formats.date.html
                                • datetime.formats.html
                                • datetime.formats.relative.html
                                • datetime.formats.time.html
                                • datetime.getlasterrors.html
                                • datetime.getoffset.html
                                • datetime.gettimestamp.html
                                • datetime.gettimezone.html
                                • datetime.installation.html
                                • datetime.modify.html
                                • datetime.requirements.html
                                • datetime.resources.html
                                • datetime.set-state.html
                                • datetime.setdate.html
                                • datetime.setisodate.html
                                • datetime.settime.html
                                • datetime.settimestamp.html
                                • datetime.settimezone.html
                                • datetime.setup.html
                                • datetime.sub.html
                                • datetime.wakeup.html
                                • datetimeimmutable.add.html
                                • datetimeimmutable.construct.html
                                • datetimeimmutable.createfromformat.html
                                • datetimeimmutable.createfrommutable.html
                                • datetimeimmutable.getlasterrors.html
                                • datetimeimmutable.modify.html
                                • datetimeimmutable.set-state.html
                                • datetimeimmutable.setdate.html
                                • datetimeimmutable.setisodate.html
                                • datetimeimmutable.settime.html
                                • datetimeimmutable.settimestamp.html
                                • datetimeimmutable.settimezone.html
                                • datetimeimmutable.sub.html
                                • datetimezone.construct.html
                                • datetimezone.getlocation.html
                                • datetimezone.getname.html
                                • datetimezone.getoffset.html
                                • datetimezone.gettransitions.html
                                • datetimezone.listabbreviations.html
                                • datetimezone.listidentifiers.html
                                • dba.configuration.html
                                • dba.constants.html
                                • dba.example.html
                                • dba.examples.html
                                • dba.installation.html
                                • dba.requirements.html
                                • dba.resources.html
                                • dba.setup.html
                                • dbase.configuration.html
                                • dbase.constants.html
                                • dbase.installation.html
                                • dbase.requirements.html
                                • dbase.resources.html
                                • dbase.setup.html
                                • dbplus.configuration.html
                                • dbplus.constants.html
                                • dbplus.errorcodes.html
                                • dbplus.installation.html
                                • dbplus.requirements.html
                                • dbplus.resources.html
                                • dbplus.setup.html
                                • dbx.configuration.html
                                • dbx.installation.html
                                • dbx.requirements.html
                                • dbx.resources.html
                                • dbx.setup.html
                                • debugger-about.html
                                • debugger.html
                                • dio.configuration.html
                                • dio.constants.html
                                • dio.installation.html
                                • dio.requirements.html
                                • dio.resources.html
                                • dio.setup.html
                                • dir.configuration.html
                                • dir.constants.html
                                • dir.installation.html
                                • dir.requirements.html
                                • dir.resources.html
                                • dir.setup.html
                                • directory.close.html
                                • directory.read.html
                                • directory.rewind.html
                                • directoryiterator.construct.html
                                • directoryiterator.current.html
                                • directoryiterator.getatime.html
                                • directoryiterator.getbasename.html
                                • directoryiterator.getctime.html
                                • directoryiterator.getextension.html
                                • directoryiterator.getfilename.html
                                • directoryiterator.getgroup.html
                                • directoryiterator.getinode.html
                                • directoryiterator.getmtime.html
                                • directoryiterator.getowner.html
                                • directoryiterator.getpath.html
                                • directoryiterator.getpathname.html
                                • directoryiterator.getperms.html
                                • directoryiterator.getsize.html
                                • directoryiterator.gettype.html
                                • directoryiterator.isdir.html
                                • directoryiterator.isdot.html
                                • directoryiterator.isexecutable.html
                                • directoryiterator.isfile.html
                                • directoryiterator.islink.html
                                • directoryiterator.isreadable.html
                                • directoryiterator.iswritable.html
                                • directoryiterator.key.html
                                • directoryiterator.next.html
                                • directoryiterator.rewind.html
                                • directoryiterator.seek.html
                                • directoryiterator.tostring.html
                                • directoryiterator.valid.html
                                • doc.changelog.html
                                • dom.configuration.html
                                • dom.constants.html
                                • dom.examples.html
                                • dom.installation.html
                                • dom.requirements.html
                                • dom.resources.html
                                • dom.setup.html
                                • domattr.construct.html
                                • domattr.isid.html
                                • domcdatasection.construct.html
                                • domcharacterdata.appenddata.html
                                • domcharacterdata.deletedata.html
                                • domcharacterdata.insertdata.html
                                • domcharacterdata.replacedata.html
                                • domcharacterdata.substringdata.html
                                • domcomment.construct.html
                                • domdocument.construct.html
                                • domdocument.createattribute.html
                                • domdocument.createattributens.html
                                • domdocument.createcdatasection.html
                                • domdocument.createcomment.html
                                • domdocument.createdocumentfragment.html
                                • domdocument.createelement.html
                                • domdocument.createelementns.html
                                • domdocument.createentityreference.html
                                • domdocument.createprocessinginstruction.html
                                • domdocument.createtextnode.html
                                • domdocument.getelementbyid.html
                                • domdocument.getelementsbytagname.html
                                • domdocument.getelementsbytagnamens.html
                                • domdocument.importnode.html
                                • domdocument.load.html
                                • domdocument.loadhtml.html
                                • domdocument.loadhtmlfile.html
                                • domdocument.loadxml.html
                                • domdocument.normalizedocument.html
                                • domdocument.registernodeclass.html
                                • domdocument.relaxngvalidate.html
                                • domdocument.relaxngvalidatesource.html
                                • domdocument.save.html
                                • domdocument.savehtml.html
                                • domdocument.savehtmlfile.html
                                • domdocument.savexml.html
                                • domdocument.schemavalidate.html
                                • domdocument.schemavalidatesource.html
                                • domdocument.validate.html
                                • domdocument.xinclude.html
                                • domdocumentfragment.appendxml.html
                                • domelement.construct.html
                                • domelement.getattribute.html
                                • domelement.getattributenode.html
                                • domelement.getattributenodens.html
                                • domelement.getattributens.html
                                • domelement.getelementsbytagname.html
                                • domelement.getelementsbytagnamens.html
                                • domelement.hasattribute.html
                                • domelement.hasattributens.html
                                • domelement.removeattribute.html
                                • domelement.removeattributenode.html
                                • domelement.removeattributens.html
                                • domelement.setattribute.html
                                • domelement.setattributenode.html
                                • domelement.setattributenodens.html
                                • domelement.setattributens.html
                                • domelement.setidattribute.html
                                • domelement.setidattributenode.html
                                • domelement.setidattributens.html
                                • domentityreference.construct.html
                                • domimplementation.construct.html
                                • domimplementation.createdocument.html
                                • domimplementation.createdocumenttype.html
                                • domimplementation.hasfeature.html
                                • domnamednodemap.getnameditem.html
                                • domnamednodemap.getnameditemns.html
                                • domnamednodemap.item.html
                                • domnode.appendchild.html
                                • domnode.c14n.html
                                • domnode.c14nfile.html
                                • domnode.clonenode.html
                                • domnode.getlineno.html
                                • domnode.getnodepath.html
                                • domnode.hasattributes.html
                                • domnode.haschildnodes.html
                                • domnode.insertbefore.html
                                • domnode.isdefaultnamespace.html
                                • domnode.issamenode.html
                                • domnode.issupported.html
                                • domnode.lookupnamespaceuri.html
                                • domnode.lookupprefix.html
                                • domnode.normalize.html
                                • domnode.removechild.html
                                • domnode.replacechild.html
                                • domnodelist.item.html
                                • domprocessinginstruction.construct.html
                                • domtext.construct.html
                                • domtext.iswhitespaceinelementcontent.html
                                • domtext.splittext.html
                                • domxpath.construct.html
                                • domxpath.evaluate.html
                                • domxpath.query.html
                                • domxpath.registernamespace.html
                                • domxpath.registerphpfunctions.html
                                • eio.configuration.html
                                • eio.constants.html
                                • eio.examples.html
                                • eio.installation.html
                                • eio.requirements.html
                                • eio.resources.html
                                • eio.setup.html
                                • emptyiterator.current.html
                                • emptyiterator.key.html
                                • emptyiterator.next.html
                                • emptyiterator.rewind.html
                                • emptyiterator.valid.html
                                • enchant.configuration.html
                                • enchant.constants.html
                                • enchant.examples.html
                                • enchant.installation.html
                                • enchant.requirements.html
                                • enchant.resources.html
                                • enchant.setup.html
                                • error.clone.html
                                • error.construct.html
                                • error.getcode.html
                                • error.getfile.html
                                • error.getline.html
                                • error.getmessage.html
                                • error.getprevious.html
                                • error.gettrace.html
                                • error.gettraceasstring.html
                                • error.tostring.html
                                • errorexception.construct.html
                                • errorexception.getseverity.html
                                • errorfunc.configuration.html
                                • errorfunc.constants.html
                                • errorfunc.examples.html
                                • errorfunc.installation.html
                                • errorfunc.requirements.html
                                • errorfunc.resources.html
                                • errorfunc.setup.html
                                • ev.backend.html
                                • ev.configuration.html
                                • ev.depth.html
                                • ev.embeddablebackends.html
                                • ev.examples.html
                                • ev.feedsignal.html
                                • ev.feedsignalevent.html
                                • ev.global.constants.html
                                • ev.installation.html
                                • ev.iteration.html
                                • ev.now.html
                                • ev.nowupdate.html
                                • ev.periodic-modes.html
                                • ev.recommendedbackends.html
                                • ev.requirements.html
                                • ev.resources.html
                                • ev.resume.html
                                • ev.run.html
                                • ev.setup.html
                                • ev.sleep.html
                                • ev.stop.html
                                • ev.supportedbackends.html
                                • ev.suspend.html
                                • ev.time.html
                                • ev.verify.html
                                • ev.watcher-callbacks.html
                                • ev.watchers.html
                                • evcheck.construct.html
                                • evcheck.createstopped.html
                                • evchild.construct.html
                                • evchild.createstopped.html
                                • evchild.set.html
                                • evembed.construct.html
                                • evembed.createstopped.html
                                • evembed.set.html
                                • evembed.sweep.html
                                • event.add.html
                                • event.addsignal.html
                                • event.addtimer.html
                                • event.callbacks.html
                                • event.configuration.html
                                • event.construct.html
                                • event.constructing.signal.events.html
                                • event.del.html
                                • event.delsignal.html
                                • event.deltimer.html
                                • event.examples.html
                                • event.flags.html
                                • event.free.html
                                • event.getsupportedmethods.html
                                • event.installation.html
                                • event.pending.html
                                • event.persistence.html
                                • event.requirements.html
                                • event.resources.html
                                • event.set.html
                                • event.setpriority.html
                                • event.settimer.html
                                • event.setup.html
                                • event.signal.html
                                • event.timer.html
                                • eventbase.construct.html
                                • eventbase.dispatch.html
                                • eventbase.exit.html
                                • eventbase.free.html
                                • eventbase.getfeatures.html
                                • eventbase.getmethod.html
                                • eventbase.gettimeofdaycached.html
                                • eventbase.gotexit.html
                                • eventbase.gotstop.html
                                • eventbase.loop.html
                                • eventbase.priorityinit.html
                                • eventbase.reinit.html
                                • eventbase.stop.html
                                • eventbuffer.add.html
                                • eventbuffer.addbuffer.html
                                • eventbuffer.appendfrom.html
                                • eventbuffer.construct.html
                                • eventbuffer.copyout.html
                                • eventbuffer.drain.html
                                • eventbuffer.enablelocking.html
                                • eventbuffer.expand.html
                                • eventbuffer.freeze.html
                                • eventbuffer.lock.html
                                • eventbuffer.prepend.html
                                • eventbuffer.prependbuffer.html
                                • eventbuffer.pullup.html
                                • eventbuffer.read.html
                                • eventbuffer.readfrom.html
                                • eventbuffer.readline.html
                                • eventbuffer.search.html
                                • eventbuffer.searcheol.html
                                • eventbuffer.substr.html
                                • eventbuffer.unfreeze.html
                                • eventbuffer.unlock.html
                                • eventbuffer.write.html
                                • eventbufferevent.about.callbacks.html
                                • eventbufferevent.close.html
                                • eventbufferevent.connect.html
                                • eventbufferevent.connecthost.html
                                • eventbufferevent.construct.html
                                • eventbufferevent.createpair.html
                                • eventbufferevent.disable.html
                                • eventbufferevent.enable.html
                                • eventbufferevent.free.html
                                • eventbufferevent.getdnserrorstring.html
                                • eventbufferevent.getenabled.html
                                • eventbufferevent.getinput.html
                                • eventbufferevent.getoutput.html
                                • eventbufferevent.read.html
                                • eventbufferevent.readbuffer.html
                                • eventbufferevent.setcallbacks.html
                                • eventbufferevent.setpriority.html
                                • eventbufferevent.settimeouts.html
                                • eventbufferevent.setwatermark.html
                                • eventbufferevent.sslerror.html
                                • eventbufferevent.sslfilter.html
                                • eventbufferevent.sslgetcipherinfo.html
                                • eventbufferevent.sslgetciphername.html
                                • eventbufferevent.sslgetcipherversion.html
                                • eventbufferevent.sslgetprotocol.html
                                • eventbufferevent.sslrenegotiate.html
                                • eventbufferevent.sslsocket.html
                                • eventbufferevent.write.html
                                • eventbufferevent.writebuffer.html
                                • eventconfig.avoidmethod.html
                                • eventconfig.construct.html
                                • eventconfig.requirefeatures.html
                                • eventconfig.setmaxdispatchinterval.html
                                • eventdnsbase.addnameserverip.html
                                • eventdnsbase.addsearch.html
                                • eventdnsbase.clearsearch.html
                                • eventdnsbase.construct.html
                                • eventdnsbase.countnameservers.html
                                • eventdnsbase.loadhosts.html
                                • eventdnsbase.parseresolvconf.html
                                • eventdnsbase.setoption.html
                                • eventdnsbase.setsearchndots.html
                                • eventhttp.accept.html
                                • eventhttp.addserveralias.html
                                • eventhttp.bind.html
                                • eventhttp.construct.html
                                • eventhttp.removeserveralias.html
                                • eventhttp.setallowedmethods.html
                                • eventhttp.setcallback.html
                                • eventhttp.setdefaultcallback.html
                                • eventhttp.setmaxbodysize.html
                                • eventhttp.setmaxheaderssize.html
                                • eventhttp.settimeout.html
                                • eventhttpconnection.construct.html
                                • eventhttpconnection.getbase.html
                                • eventhttpconnection.getpeer.html
                                • eventhttpconnection.makerequest.html
                                • eventhttpconnection.setclosecallback.html
                                • eventhttpconnection.setlocaladdress.html
                                • eventhttpconnection.setlocalport.html
                                • eventhttpconnection.setmaxbodysize.html
                                • eventhttpconnection.setmaxheaderssize.html
                                • eventhttpconnection.setretries.html
                                • eventhttpconnection.settimeout.html
                                • eventhttprequest.addheader.html
                                • eventhttprequest.cancel.html
                                • eventhttprequest.clearheaders.html
                                • eventhttprequest.closeconnection.html
                                • eventhttprequest.construct.html
                                • eventhttprequest.findheader.html
                                • eventhttprequest.free.html
                                • eventhttprequest.getbufferevent.html
                                • eventhttprequest.getcommand.html
                                • eventhttprequest.getconnection.html
                                • eventhttprequest.gethost.html
                                • eventhttprequest.getinputbuffer.html
                                • eventhttprequest.getinputheaders.html
                                • eventhttprequest.getoutputbuffer.html
                                • eventhttprequest.getoutputheaders.html
                                • eventhttprequest.getresponsecode.html
                                • eventhttprequest.geturi.html
                                • eventhttprequest.removeheader.html
                                • eventhttprequest.senderror.html
                                • eventhttprequest.sendreply.html
                                • eventhttprequest.sendreplychunk.html
                                • eventhttprequest.sendreplyend.html
                                • eventhttprequest.sendreplystart.html
                                • eventlistener.construct.html
                                • eventlistener.disable.html
                                • eventlistener.enable.html
                                • eventlistener.getbase.html
                                • eventlistener.getsocketname.html
                                • eventlistener.setcallback.html
                                • eventlistener.seterrorcallback.html
                                • eventsslcontext.construct.html
                                • eventutil.construct.html
                                • eventutil.getlastsocketerrno.html
                                • eventutil.getlastsocketerror.html
                                • eventutil.getsocketfd.html
                                • eventutil.getsocketname.html
                                • eventutil.setsocketoption.html
                                • eventutil.sslrandpoll.html
                                • evfork.construct.html
                                • evfork.createstopped.html
                                • evidle.construct.html
                                • evidle.createstopped.html
                                • evio.construct.html
                                • evio.createstopped.html
                                • evio.set.html
                                • evloop.backend.html
                                • evloop.check.html
                                • evloop.child.html
                                • evloop.construct.html
                                • evloop.defaultloop.html
                                • evloop.embed.html
                                • evloop.fork.html
                                • evloop.idle.html
                                • evloop.invokepending.html
                                • evloop.io.html
                                • evloop.loopfork.html
                                • evloop.now.html
                                • evloop.nowupdate.html
                                • evloop.periodic.html
                                • evloop.prepare.html
                                • evloop.resume.html
                                • evloop.run.html
                                • evloop.signal.html
                                • evloop.stat.html
                                • evloop.stop.html
                                • evloop.suspend.html
                                • evloop.timer.html
                                • evloop.verify.html
                                • evperiodic.again.html
                                • evperiodic.at.html
                                • evperiodic.construct.html
                                • evperiodic.createstopped.html
                                • evperiodic.set.html
                                • evprepare.construct.html
                                • evprepare.createstopped.html
                                • evsignal.construct.html
                                • evsignal.createstopped.html
                                • evsignal.set.html
                                • evstat.attr.html
                                • evstat.construct.html
                                • evstat.createstopped.html
                                • evstat.prev.html
                                • evstat.set.html
                                • evstat.stat.html
                                • evtimer.again.html
                                • evtimer.construct.html
                                • evtimer.createstopped.html
                                • evtimer.set.html
                                • evwatcher.clear.html
                                • evwatcher.construct.html
                                • evwatcher.feed.html
                                • evwatcher.getloop.html
                                • evwatcher.invoke.html
                                • evwatcher.keepalive.html
                                • evwatcher.setcallback.html
                                • evwatcher.start.html
                                • evwatcher.stop.html
                                • example.xml-external-entity.html
                                • example.xml-map-tags.html
                                • example.xml-structure.html
                                • exception.clone.html
                                • exception.construct.html
                                • exception.getcode.html
                                • exception.getfile.html
                                • exception.getline.html
                                • exception.getmessage.html
                                • exception.getprevious.html
                                • exception.gettrace.html
                                • exception.gettraceasstring.html
                                • exception.tostring.html
                                • exec.configuration.html
                                • exec.constants.html
                                • exec.installation.html
                                • exec.requirements.html
                                • exec.resources.html
                                • exec.setup.html
                                • exif.configuration.html
                                • exif.constants.html
                                • exif.installation.html
                                • exif.requirements.html
                                • exif.resources.html
                                • exif.setup.html
                                • expect.configuration.html
                                • expect.constants.html
                                • expect.examples-usage.html
                                • expect.examples.html
                                • expect.installation.html
                                • expect.requirements.html
                                • expect.resources.html
                                • expect.setup.html
                                • extensions.alphabetical.html
                                • extensions.html
                                • extensions.membership.html
                                • extensions.state.html
                                • fam.configuration.html
                                • fam.constants.html
                                • fam.installation.html
                                • fam.requirements.html
                                • fam.resources.html
                                • fam.setup.html
                                • fann.configuration.html
                                • fann.constants.html
                                • fann.examples-1.html
                                • fann.examples.html
                                • fann.installation.html
                                • fann.requirements.html
                                • fann.resources.html
                                • fann.setup.html
                                • fannconnection.construct.html
                                • fannconnection.getfromneuron.html
                                • fannconnection.gettoneuron.html
                                • fannconnection.getweight.html
                                • fannconnection.setweight.html
                                • faq.build.html
                                • faq.com.html
                                • faq.databases.html
                                • faq.general.html
                                • faq.html
                                • faq.html.html
                                • faq.installation.html
                                • faq.mailinglist.html
                                • faq.migration5.html
                                • faq.misc.html
                                • faq.obtaining.html
                                • faq.passwords.html
                                • faq.using.html
                                • fbsql.configuration.html
                                • fbsql.constants.html
                                • fbsql.installation.html
                                • fbsql.requirements.html
                                • fbsql.resources.html
                                • fbsql.setup.html
                                • fdf.configuration.html
                                • fdf.constants.html
                                • fdf.examples.html
                                • fdf.installation.html
                                • fdf.requirements.html
                                • fdf.resources.html
                                • fdf.setup.html
                                • features.commandline.differences.html
                                • features.commandline.html
                                • features.commandline.ini.html
                                • features.commandline.interactive.html
                                • features.commandline.introduction.html
                                • features.commandline.io-streams.html
                                • features.commandline.options.html
                                • features.commandline.usage.html
                                • features.commandline.webserver.html
                                • features.connection-handling.html
                                • features.cookies.html
                                • features.dtrace.dtrace.html
                                • features.dtrace.html
                                • features.dtrace.introduction.html
                                • features.dtrace.systemtap.html
                                • features.file-upload.common-pitfalls.html
                                • features.file-upload.errors.html
                                • features.file-upload.html
                                • features.file-upload.multiple.html
                                • features.file-upload.post-method.html
                                • features.file-upload.put-method.html
                                • features.gc.collecting-cycles.html
                                • features.gc.html
                                • features.gc.performance-considerations.html
                                • features.gc.refcounting-basics.html
                                • features.html
                                • features.http-auth.html
                                • features.persistent-connections.html
                                • features.remote-files.html
                                • features.safe-mode.functions.html
                                • features.safe-mode.html
                                • features.sessions.html
                                • features.xforms.html
                                • fileinfo.configuration.html
                                • fileinfo.constants.html
                                • fileinfo.installation.html
                                • fileinfo.requirements.html
                                • fileinfo.resources.html
                                • fileinfo.setup.html
                                • filepro.configuration.html
                                • filepro.constants.html
                                • filepro.installation.html
                                • filepro.requirements.html
                                • filepro.resources.html
                                • filepro.setup.html
                                • filesystem.configuration.html
                                • filesystem.constants.html
                                • filesystem.installation.html
                                • filesystem.requirements.html
                                • filesystem.resources.html
                                • filesystem.setup.html
                                • filesystemiterator.construct.html
                                • filesystemiterator.current.html
                                • filesystemiterator.getflags.html
                                • filesystemiterator.key.html
                                • filesystemiterator.next.html
                                • filesystemiterator.rewind.html
                                • filesystemiterator.setflags.html
                                • filter.configuration.html
                                • filter.constants.html
                                • filter.examples.html
                                • filter.examples.sanitization.html
                                • filter.examples.validation.html
                                • filter.filters.flags.html
                                • filter.filters.html
                                • filter.filters.misc.html
                                • filter.filters.sanitize.html
                                • filter.filters.validate.html
                                • filter.installation.html
                                • filter.requirements.html
                                • filter.resources.html
                                • filter.setup.html
                                • filteriterator.accept.html
                                • filteriterator.construct.html
                                • filteriterator.current.html
                                • filteriterator.getinneriterator.html
                                • filteriterator.key.html
                                • filteriterator.next.html
                                • filteriterator.rewind.html
                                • filteriterator.valid.html
                                • filters.compression.html
                                • filters.convert.html
                                • filters.encryption.html
                                • filters.html
                                • filters.string.html
                                • finfo.buffer.html
                                • finfo.construct.html
                                • finfo.file.html
                                • finfo.set-flags.html
                                • fpm.setup.html
                                • fribidi.configuration.html
                                • fribidi.constants.html
                                • fribidi.installation.html
                                • fribidi.requirements.html
                                • fribidi.resources.html
                                • fribidi.setup.html
                                • ftp.configuration.html
                                • ftp.constants.html
                                • ftp.examples-basic.html
                                • ftp.examples.html
                                • ftp.installation.html
                                • ftp.requirements.html
                                • ftp.resources.html
                                • ftp.setup.html
                                • funchand.configuration.html
                                • funchand.constants.html
                                • funchand.installation.html
                                • funchand.requirements.html
                                • funchand.resources.html
                                • funchand.setup.html
                                • funcref.html
                                • function.abs.html
                                • function.acos.html
                                • function.acosh.html
                                • function.addcslashes.html
                                • function.addslashes.html
                                • function.apache-child-terminate.html
                                • function.apache-get-modules.html
                                • function.apache-get-version.html
                                • function.apache-getenv.html
                                • function.apache-lookup-uri.html
                                • function.apache-note.html
                                • function.apache-request-headers.html
                                • function.apache-reset-timeout.html
                                • function.apache-response-headers.html
                                • function.apache-setenv.html
                                • function.apc-add.html
                                • function.apc-bin-dump.html
                                • function.apc-bin-dumpfile.html
                                • function.apc-bin-load.html
                                • function.apc-bin-loadfile.html
                                • function.apc-cache-info.html
                                • function.apc-cas.html
                                • function.apc-clear-cache.html
                                • function.apc-compile-file.html
                                • function.apc-dec.html
                                • function.apc-define-constants.html
                                • function.apc-delete-file.html
                                • function.apc-delete.html
                                • function.apc-exists.html
                                • function.apc-fetch.html
                                • function.apc-inc.html
                                • function.apc-load-constants.html
                                • function.apc-sma-info.html
                                • function.apc-store.html
                                • function.apcu-add.html
                                • function.apcu-cache-info.html
                                • function.apcu-cas.html
                                • function.apcu-clear-cache.html
                                • function.apcu-dec.html
                                • function.apcu-delete.html
                                • function.apcu-entry.html
                                • function.apcu-exists.html
                                • function.apcu-fetch.html
                                • function.apcu-inc.html
                                • function.apcu-sma-info.html
                                • function.apcu-store.html
                                • function.apd-breakpoint.html
                                • function.apd-callstack.html
                                • function.apd-clunk.html
                                • function.apd-continue.html
                                • function.apd-croak.html
                                • function.apd-dump-function-table.html
                                • function.apd-dump-persistent-resources.html
                                • function.apd-dump-regular-resources.html
                                • function.apd-echo.html
                                • function.apd-get-active-symbols.html
                                • function.apd-set-pprof-trace.html
                                • function.apd-set-session-trace-socket.html
                                • function.apd-set-session-trace.html
                                • function.apd-set-session.html
                                • function.array-change-key-case.html
                                • function.array-chunk.html
                                • function.array-column.html
                                • function.array-combine.html
                                • function.array-count-values.html
                                • function.array-diff-assoc.html
                                • function.array-diff-key.html
                                • function.array-diff-uassoc.html
                                • function.array-diff-ukey.html
                                • function.array-diff.html
                                • function.array-fill-keys.html
                                • function.array-fill.html
                                • function.array-filter.html
                                • function.array-flip.html
                                • function.array-intersect-assoc.html
                                • function.array-intersect-key.html
                                • function.array-intersect-uassoc.html
                                • function.array-intersect-ukey.html
                                • function.array-intersect.html
                                • function.array-key-exists.html
                                • function.array-keys.html
                                • function.array-map.html
                                • function.array-merge-recursive.html
                                • function.array-merge.html
                                • function.array-multisort.html
                                • function.array-pad.html
                                • function.array-pop.html
                                • function.array-product.html
                                • function.array-push.html
                                • function.array-rand.html
                                • function.array-reduce.html
                                • function.array-replace-recursive.html
                                • function.array-replace.html
                                • function.array-reverse.html
                                • function.array-search.html
                                • function.array-shift.html
                                • function.array-slice.html
                                • function.array-splice.html
                                • function.array-sum.html
                                • function.array-udiff-assoc.html
                                • function.array-udiff-uassoc.html
                                • function.array-udiff.html
                                • function.array-uintersect-assoc.html
                                • function.array-uintersect-uassoc.html
                                • function.array-uintersect.html
                                • function.array-unique.html
                                • function.array-unshift.html
                                • function.array-values.html
                                • function.array-walk-recursive.html
                                • function.array-walk.html
                                • function.array.html
                                • function.arsort.html
                                • function.asin.html
                                • function.asinh.html
                                • function.asort.html
                                • function.assert-options.html
                                • function.assert.html
                                • function.atan.html
                                • function.atan2.html
                                • function.atanh.html
                                • function.autoload.html
                                • function.base-convert.html
                                • function.base64-decode.html
                                • function.base64-encode.html
                                • function.basename.html
                                • function.bbcode-add-element.html
                                • function.bbcode-add-smiley.html
                                • function.bbcode-create.html
                                • function.bbcode-destroy.html
                                • function.bbcode-parse.html
                                • function.bbcode-set-arg-parser.html
                                • function.bbcode-set-flags.html
                                • function.bcadd.html
                                • function.bccomp.html
                                • function.bcdiv.html
                                • function.bcmod.html
                                • function.bcmul.html
                                • function.bcompiler-load-exe.html
                                • function.bcompiler-load.html
                                • function.bcompiler-parse-class.html
                                • function.bcompiler-read.html
                                • function.bcompiler-write-class.html
                                • function.bcompiler-write-constant.html
                                • function.bcompiler-write-exe-footer.html
                                • function.bcompiler-write-file.html
                                • function.bcompiler-write-footer.html
                                • function.bcompiler-write-function.html
                                • function.bcompiler-write-functions-from-file.html
                                • function.bcompiler-write-header.html
                                • function.bcompiler-write-included-filename.html
                                • function.bcpow.html
                                • function.bcpowmod.html
                                • function.bcscale.html
                                • function.bcsqrt.html
                                • function.bcsub.html
                                • function.bin2hex.html
                                • function.bind-textdomain-codeset.html
                                • function.bindec.html
                                • function.bindtextdomain.html
                                • function.blenc-encrypt.html
                                • function.boolval.html
                                • function.bson-decode.html
                                • function.bson-encode.html
                                • function.bzclose.html
                                • function.bzcompress.html
                                • function.bzdecompress.html
                                • function.bzerrno.html
                                • function.bzerror.html
                                • function.bzerrstr.html
                                • function.bzflush.html
                                • function.bzopen.html
                                • function.bzread.html
                                • function.bzwrite.html
                                • function.cairo-create.html
                                • function.cairo-font-face-get-type.html
                                • function.cairo-font-face-status.html
                                • function.cairo-font-options-create.html
                                • function.cairo-font-options-equal.html
                                • function.cairo-font-options-get-antialias.html
                                • function.cairo-font-options-get-hint-metrics.html
                                • function.cairo-font-options-get-hint-style.html
                                • function.cairo-font-options-get-subpixel-order.html
                                • function.cairo-font-options-hash.html
                                • function.cairo-font-options-merge.html
                                • function.cairo-font-options-set-antialias.html
                                • function.cairo-font-options-set-hint-metrics.html
                                • function.cairo-font-options-set-hint-style.html
                                • function.cairo-font-options-set-subpixel-order.html
                                • function.cairo-font-options-status.html
                                • function.cairo-format-stride-for-width.html
                                • function.cairo-image-surface-create-for-data.html
                                • function.cairo-image-surface-create-from-png.html
                                • function.cairo-image-surface-create.html
                                • function.cairo-image-surface-get-data.html
                                • function.cairo-image-surface-get-format.html
                                • function.cairo-image-surface-get-height.html
                                • function.cairo-image-surface-get-stride.html
                                • function.cairo-image-surface-get-width.html
                                • function.cairo-matrix-create-scale.html
                                • function.cairo-matrix-create-translate.html
                                • function.cairo-matrix-invert.html
                                • function.cairo-matrix-multiply.html
                                • function.cairo-matrix-rotate.html
                                • function.cairo-matrix-transform-distance.html
                                • function.cairo-matrix-transform-point.html
                                • function.cairo-matrix-translate.html
                                • function.cairo-pattern-add-color-stop-rgb.html
                                • function.cairo-pattern-add-color-stop-rgba.html
                                • function.cairo-pattern-create-for-surface.html
                                • function.cairo-pattern-create-linear.html
                                • function.cairo-pattern-create-radial.html
                                • function.cairo-pattern-create-rgb.html
                                • function.cairo-pattern-create-rgba.html
                                • function.cairo-pattern-get-color-stop-count.html
                                • function.cairo-pattern-get-color-stop-rgba.html
                                • function.cairo-pattern-get-extend.html
                                • function.cairo-pattern-get-filter.html
                                • function.cairo-pattern-get-linear-points.html
                                • function.cairo-pattern-get-matrix.html
                                • function.cairo-pattern-get-radial-circles.html
                                • function.cairo-pattern-get-rgba.html
                                • function.cairo-pattern-get-surface.html
                                • function.cairo-pattern-get-type.html
                                • function.cairo-pattern-set-extend.html
                                • function.cairo-pattern-set-filter.html
                                • function.cairo-pattern-set-matrix.html
                                • function.cairo-pattern-status.html
                                • function.cairo-pdf-surface-create.html
                                • function.cairo-pdf-surface-set-size.html
                                • function.cairo-ps-get-levels.html
                                • function.cairo-ps-level-to-string.html
                                • function.cairo-ps-surface-create.html
                                • function.cairo-ps-surface-dsc-begin-page-setup.html
                                • function.cairo-ps-surface-dsc-begin-setup.html
                                • function.cairo-ps-surface-dsc-comment.html
                                • function.cairo-ps-surface-get-eps.html
                                • function.cairo-ps-surface-restrict-to-level.html
                                • function.cairo-ps-surface-set-eps.html
                                • function.cairo-ps-surface-set-size.html
                                • function.cairo-scaled-font-create.html
                                • function.cairo-scaled-font-extents.html
                                • function.cairo-scaled-font-get-ctm.html
                                • function.cairo-scaled-font-get-font-face.html
                                • function.cairo-scaled-font-get-font-matrix.html
                                • function.cairo-scaled-font-get-font-options.html
                                • function.cairo-scaled-font-get-scale-matrix.html
                                • function.cairo-scaled-font-get-type.html
                                • function.cairo-scaled-font-glyph-extents.html
                                • function.cairo-scaled-font-status.html
                                • function.cairo-scaled-font-text-extents.html
                                • function.cairo-surface-copy-page.html
                                • function.cairo-surface-create-similar.html
                                • function.cairo-surface-finish.html
                                • function.cairo-surface-flush.html
                                • function.cairo-surface-get-content.html
                                • function.cairo-surface-get-device-offset.html
                                • function.cairo-surface-get-font-options.html
                                • function.cairo-surface-get-type.html
                                • function.cairo-surface-mark-dirty-rectangle.html
                                • function.cairo-surface-mark-dirty.html
                                • function.cairo-surface-set-device-offset.html
                                • function.cairo-surface-set-fallback-resolution.html
                                • function.cairo-surface-show-page.html
                                • function.cairo-surface-status.html
                                • function.cairo-surface-write-to-png.html
                                • function.cairo-svg-surface-create.html
                                • function.cairo-svg-surface-restrict-to-version.html
                                • function.cairo-svg-version-to-string.html
                                • function.cal-days-in-month.html
                                • function.cal-from-jd.html
                                • function.cal-info.html
                                • function.cal-to-jd.html
                                • function.calcul-hmac.html
                                • function.calculhmac.html
                                • function.call-user-func-array.html
                                • function.call-user-func.html
                                • function.call-user-method-array.html
                                • function.call-user-method.html
                                • function.ceil.html
                                • function.chdb-create.html
                                • function.chdir.html
                                • function.checkdate.html
                                • function.checkdnsrr.html
                                • function.chgrp.html
                                • function.chmod.html
                                • function.chop.html
                                • function.chown.html
                                • function.chr.html
                                • function.chroot.html
                                • function.chunk-split.html
                                • function.class-alias.html
                                • function.class-exists.html
                                • function.class-implements.html
                                • function.class-parents.html
                                • function.class-uses.html
                                • function.classkit-import.html
                                • function.classkit-method-add.html
                                • function.classkit-method-copy.html
                                • function.classkit-method-redefine.html
                                • function.classkit-method-remove.html
                                • function.classkit-method-rename.html
                                • function.clearstatcache.html
                                • function.cli-get-process-title.html
                                • function.cli-set-process-title.html
                                • function.closedir.html
                                • function.closelog.html
                                • function.com-create-guid.html
                                • function.com-event-sink.html
                                • function.com-get-active-object.html
                                • function.com-load-typelib.html
                                • function.com-message-pump.html
                                • function.com-print-typeinfo.html
                                • function.compact.html
                                • function.connection-aborted.html
                                • function.connection-status.html
                                • function.constant.html
                                • function.convert-cyr-string.html
                                • function.convert-uudecode.html
                                • function.convert-uuencode.html
                                • function.copy.html
                                • function.cos.html
                                • function.cosh.html
                                • function.count-chars.html
                                • function.count.html
                                • function.crack-check.html
                                • function.crack-closedict.html
                                • function.crack-getlastmessage.html
                                • function.crack-opendict.html
                                • function.crc32.html
                                • function.create-function.html
                                • function.crypt.html
                                • function.ctype-alnum.html
                                • function.ctype-alpha.html
                                • function.ctype-cntrl.html
                                • function.ctype-digit.html
                                • function.ctype-graph.html
                                • function.ctype-lower.html
                                • function.ctype-print.html
                                • function.ctype-punct.html
                                • function.ctype-space.html
                                • function.ctype-upper.html
                                • function.ctype-xdigit.html
                                • function.cubrid-affected-rows.html
                                • function.cubrid-bind.html
                                • function.cubrid-client-encoding.html
                                • function.cubrid-close-prepare.html
                                • function.cubrid-close-request.html
                                • function.cubrid-close.html
                                • function.cubrid-col-get.html
                                • function.cubrid-col-size.html
                                • function.cubrid-column-names.html
                                • function.cubrid-column-types.html
                                • function.cubrid-commit.html
                                • function.cubrid-connect-with-url.html
                                • function.cubrid-connect.html
                                • function.cubrid-current-oid.html
                                • function.cubrid-data-seek.html
                                • function.cubrid-db-name.html
                                • function.cubrid-disconnect.html
                                • function.cubrid-drop.html
                                • function.cubrid-errno.html
                                • function.cubrid-error-code-facility.html
                                • function.cubrid-error-code.html
                                • function.cubrid-error-msg.html
                                • function.cubrid-error.html
                                • function.cubrid-execute.html
                                • function.cubrid-fetch-array.html
                                • function.cubrid-fetch-assoc.html
                                • function.cubrid-fetch-field.html
                                • function.cubrid-fetch-lengths.html
                                • function.cubrid-fetch-object.html
                                • function.cubrid-fetch-row.html
                                • function.cubrid-fetch.html
                                • function.cubrid-field-flags.html
                                • function.cubrid-field-len.html
                                • function.cubrid-field-name.html
                                • function.cubrid-field-seek.html
                                • function.cubrid-field-table.html
                                • function.cubrid-field-type.html
                                • function.cubrid-free-result.html
                                • function.cubrid-get-autocommit.html
                                • function.cubrid-get-charset.html
                                • function.cubrid-get-class-name.html
                                • function.cubrid-get-client-info.html
                                • function.cubrid-get-db-parameter.html
                                • function.cubrid-get-query-timeout.html
                                • function.cubrid-get-server-info.html
                                • function.cubrid-get.html
                                • function.cubrid-insert-id.html
                                • function.cubrid-is-instance.html
                                • function.cubrid-list-dbs.html
                                • function.cubrid-load-from-glo.html
                                • function.cubrid-lob-close.html
                                • function.cubrid-lob-export.html
                                • function.cubrid-lob-get.html
                                • function.cubrid-lob-send.html
                                • function.cubrid-lob-size.html
                                • function.cubrid-lob2-bind.html
                                • function.cubrid-lob2-close.html
                                • function.cubrid-lob2-export.html
                                • function.cubrid-lob2-import.html
                                • function.cubrid-lob2-new.html
                                • function.cubrid-lob2-read.html
                                • function.cubrid-lob2-seek.html
                                • function.cubrid-lob2-seek64.html
                                • function.cubrid-lob2-size.html
                                • function.cubrid-lob2-size64.html
                                • function.cubrid-lob2-tell.html
                                • function.cubrid-lob2-tell64.html
                                • function.cubrid-lob2-write.html
                                • function.cubrid-lock-read.html
                                • function.cubrid-lock-write.html
                                • function.cubrid-move-cursor.html
                                • function.cubrid-new-glo.html
                                • function.cubrid-next-result.html
                                • function.cubrid-num-cols.html
                                • function.cubrid-num-fields.html
                                • function.cubrid-num-rows.html
                                • function.cubrid-pconnect-with-url.html
                                • function.cubrid-pconnect.html
                                • function.cubrid-ping.html
                                • function.cubrid-prepare.html
                                • function.cubrid-put.html
                                • function.cubrid-query.html
                                • function.cubrid-real-escape-string.html
                                • function.cubrid-result.html
                                • function.cubrid-rollback.html
                                • function.cubrid-save-to-glo.html
                                • function.cubrid-schema.html
                                • function.cubrid-send-glo.html
                                • function.cubrid-seq-drop.html
                                • function.cubrid-seq-insert.html
                                • function.cubrid-seq-put.html
                                • function.cubrid-set-add.html
                                • function.cubrid-set-autocommit.html
                                • function.cubrid-set-db-parameter.html
                                • function.cubrid-set-drop.html
                                • function.cubrid-set-query-timeout.html
                                • function.cubrid-unbuffered-query.html
                                • function.cubrid-version.html
                                • function.curl-close.html
                                • function.curl-copy-handle.html
                                • function.curl-errno.html
                                • function.curl-error.html
                                • function.curl-escape.html
                                • function.curl-exec.html
                                • function.curl-file-create.html
                                • function.curl-getinfo.html
                                • function.curl-init.html
                                • function.curl-multi-add-handle.html
                                • function.curl-multi-close.html
                                • function.curl-multi-exec.html
                                • function.curl-multi-getcontent.html
                                • function.curl-multi-info-read.html
                                • function.curl-multi-init.html
                                • function.curl-multi-remove-handle.html
                                • function.curl-multi-select.html
                                • function.curl-multi-setopt.html
                                • function.curl-multi-strerror.html
                                • function.curl-pause.html
                                • function.curl-reset.html
                                • function.curl-setopt-array.html
                                • function.curl-setopt.html
                                • function.curl-share-close.html
                                • function.curl-share-init.html
                                • function.curl-share-setopt.html
                                • function.curl-strerror.html
                                • function.curl-unescape.html
                                • function.curl-version.html
                                • function.current.html
                                • function.cyrus-authenticate.html
                                • function.cyrus-bind.html
                                • function.cyrus-close.html
                                • function.cyrus-connect.html
                                • function.cyrus-query.html
                                • function.cyrus-unbind.html
                                • function.date-add.html
                                • function.date-create-from-format.html
                                • function.date-create-immutable-from-format.html
                                • function.date-create-immutable.html
                                • function.date-create.html
                                • function.date-date-set.html
                                • function.date-default-timezone-get.html
                                • function.date-default-timezone-set.html
                                • function.date-diff.html
                                • function.date-format.html
                                • function.date-get-last-errors.html
                                • function.date-interval-create-from-date-string.html
                                • function.date-interval-format.html
                                • function.date-isodate-set.html
                                • function.date-modify.html
                                • function.date-offset-get.html
                                • function.date-parse-from-format.html
                                • function.date-parse.html
                                • function.date-sub.html
                                • function.date-sun-info.html
                                • function.date-sunrise.html
                                • function.date-sunset.html
                                • function.date-time-set.html
                                • function.date-timestamp-get.html
                                • function.date-timestamp-set.html
                                • function.date-timezone-get.html
                                • function.date-timezone-set.html
                                • function.date.html
                                • function.db2-autocommit.html
                                • function.db2-bind-param.html
                                • function.db2-client-info.html
                                • function.db2-close.html
                                • function.db2-column-privileges.html
                                • function.db2-columns.html
                                • function.db2-commit.html
                                • function.db2-conn-error.html
                                • function.db2-conn-errormsg.html
                                • function.db2-connect.html
                                • function.db2-cursor-type.html
                                • function.db2-escape-string.html
                                • function.db2-exec.html
                                • function.db2-execute.html
                                • function.db2-fetch-array.html
                                • function.db2-fetch-assoc.html
                                • function.db2-fetch-both.html
                                • function.db2-fetch-object.html
                                • function.db2-fetch-row.html
                                • function.db2-field-display-size.html
                                • function.db2-field-name.html
                                • function.db2-field-num.html
                                • function.db2-field-precision.html
                                • function.db2-field-scale.html
                                • function.db2-field-type.html
                                • function.db2-field-width.html
                                • function.db2-foreign-keys.html
                                • function.db2-free-result.html
                                • function.db2-free-stmt.html
                                • function.db2-get-option.html
                                • function.db2-last-insert-id.html
                                • function.db2-lob-read.html
                                • function.db2-next-result.html
                                • function.db2-num-fields.html
                                • function.db2-num-rows.html
                                • function.db2-pclose.html
                                • function.db2-pconnect.html
                                • function.db2-prepare.html
                                • function.db2-primary-keys.html
                                • function.db2-procedure-columns.html
                                • function.db2-procedures.html
                                • function.db2-result.html
                                • function.db2-rollback.html
                                • function.db2-server-info.html
                                • function.db2-set-option.html
                                • function.db2-special-columns.html
                                • function.db2-statistics.html
                                • function.db2-stmt-error.html
                                • function.db2-stmt-errormsg.html
                                • function.db2-table-privileges.html
                                • function.db2-tables.html
                                • function.dba-close.html
                                • function.dba-delete.html
                                • function.dba-exists.html
                                • function.dba-fetch.html
                                • function.dba-firstkey.html
                                • function.dba-handlers.html
                                • function.dba-insert.html
                                • function.dba-key-split.html
                                • function.dba-list.html
                                • function.dba-nextkey.html
                                • function.dba-open.html
                                • function.dba-optimize.html
                                • function.dba-popen.html
                                • function.dba-replace.html
                                • function.dba-sync.html
                                • function.dbase-add-record.html
                                • function.dbase-close.html
                                • function.dbase-create.html
                                • function.dbase-delete-record.html
                                • function.dbase-get-header-info.html
                                • function.dbase-get-record-with-names.html
                                • function.dbase-get-record.html
                                • function.dbase-numfields.html
                                • function.dbase-numrecords.html
                                • function.dbase-open.html
                                • function.dbase-pack.html
                                • function.dbase-replace-record.html
                                • function.dbplus-add.html
                                • function.dbplus-aql.html
                                • function.dbplus-chdir.html
                                • function.dbplus-close.html
                                • function.dbplus-curr.html
                                • function.dbplus-errcode.html
                                • function.dbplus-errno.html
                                • function.dbplus-find.html
                                • function.dbplus-first.html
                                • function.dbplus-flush.html
                                • function.dbplus-freealllocks.html
                                • function.dbplus-freelock.html
                                • function.dbplus-freerlocks.html
                                • function.dbplus-getlock.html
                                • function.dbplus-getunique.html
                                • function.dbplus-info.html
                                • function.dbplus-last.html
                                • function.dbplus-lockrel.html
                                • function.dbplus-next.html
                                • function.dbplus-open.html
                                • function.dbplus-prev.html
                                • function.dbplus-rchperm.html
                                • function.dbplus-rcreate.html
                                • function.dbplus-rcrtexact.html
                                • function.dbplus-rcrtlike.html
                                • function.dbplus-resolve.html
                                • function.dbplus-restorepos.html
                                • function.dbplus-rkeys.html
                                • function.dbplus-ropen.html
                                • function.dbplus-rquery.html
                                • function.dbplus-rrename.html
                                • function.dbplus-rsecindex.html
                                • function.dbplus-runlink.html
                                • function.dbplus-rzap.html
                                • function.dbplus-savepos.html
                                • function.dbplus-setindex.html
                                • function.dbplus-setindexbynumber.html
                                • function.dbplus-sql.html
                                • function.dbplus-tcl.html
                                • function.dbplus-tremove.html
                                • function.dbplus-undo.html
                                • function.dbplus-undoprepare.html
                                • function.dbplus-unlockrel.html
                                • function.dbplus-unselect.html
                                • function.dbplus-update.html
                                • function.dbplus-xlockrel.html
                                • function.dbplus-xunlockrel.html
                                • function.dbx-close.html
                                • function.dbx-compare.html
                                • function.dbx-connect.html
                                • function.dbx-error.html
                                • function.dbx-escape-string.html
                                • function.dbx-fetch-row.html
                                • function.dbx-query.html
                                • function.dbx-sort.html
                                • function.dcgettext.html
                                • function.dcngettext.html
                                • function.debug-backtrace.html
                                • function.debug-print-backtrace.html
                                • function.debug-zval-dump.html
                                • function.decbin.html
                                • function.dechex.html
                                • function.decoct.html
                                • function.define-syslog-variables.html
                                • function.define.html
                                • function.defined.html
                                • function.deg2rad.html
                                • function.delete.html
                                • function.dgettext.html
                                • function.die.html
                                • function.dio-close.html
                                • function.dio-fcntl.html
                                • function.dio-open.html
                                • function.dio-read.html
                                • function.dio-seek.html
                                • function.dio-stat.html
                                • function.dio-tcsetattr.html
                                • function.dio-truncate.html
                                • function.dio-write.html
                                • function.dir.html
                                • function.dirname.html
                                • function.disk-free-space.html
                                • function.disk-total-space.html
                                • function.diskfreespace.html
                                • function.dl.html
                                • function.dngettext.html
                                • function.dns-check-record.html
                                • function.dns-get-mx.html
                                • function.dns-get-record.html
                                • function.dom-import-simplexml.html
                                • function.doubleval.html
                                • function.each.html
                                • function.easter-date.html
                                • function.easter-days.html
                                • function.echo.html
                                • function.eio-busy.html
                                • function.eio-cancel.html
                                • function.eio-chmod.html
                                • function.eio-chown.html
                                • function.eio-close.html
                                • function.eio-custom.html
                                • function.eio-dup2.html
                                • function.eio-event-loop.html
                                • function.eio-fallocate.html
                                • function.eio-fchmod.html
                                • function.eio-fchown.html
                                • function.eio-fdatasync.html
                                • function.eio-fstat.html
                                • function.eio-fstatvfs.html
                                • function.eio-fsync.html
                                • function.eio-ftruncate.html
                                • function.eio-futime.html
                                • function.eio-get-event-stream.html
                                • function.eio-get-last-error.html
                                • function.eio-grp-add.html
                                • function.eio-grp-cancel.html
                                • function.eio-grp-limit.html
                                • function.eio-grp.html
                                • function.eio-init.html
                                • function.eio-link.html
                                • function.eio-lstat.html
                                • function.eio-mkdir.html
                                • function.eio-mknod.html
                                • function.eio-nop.html
                                • function.eio-npending.html
                                • function.eio-nready.html
                                • function.eio-nreqs.html
                                • function.eio-nthreads.html
                                • function.eio-open.html
                                • function.eio-poll.html
                                • function.eio-read.html
                                • function.eio-readahead.html
                                • function.eio-readdir.html
                                • function.eio-readlink.html
                                • function.eio-realpath.html
                                • function.eio-rename.html
                                • function.eio-rmdir.html
                                • function.eio-seek.html
                                • function.eio-sendfile.html
                                • function.eio-set-max-idle.html
                                • function.eio-set-max-parallel.html
                                • function.eio-set-max-poll-reqs.html
                                • function.eio-set-max-poll-time.html
                                • function.eio-set-min-parallel.html
                                • function.eio-stat.html
                                • function.eio-statvfs.html
                                • function.eio-symlink.html
                                • function.eio-sync-file-range.html
                                • function.eio-sync.html
                                • function.eio-syncfs.html
                                • function.eio-truncate.html
                                • function.eio-unlink.html
                                • function.eio-utime.html
                                • function.eio-write.html
                                • function.empty.html
                                • function.enchant-broker-describe.html
                                • function.enchant-broker-dict-exists.html
                                • function.enchant-broker-free-dict.html
                                • function.enchant-broker-free.html
                                • function.enchant-broker-get-dict-path.html
                                • function.enchant-broker-get-error.html
                                • function.enchant-broker-init.html
                                • function.enchant-broker-list-dicts.html
                                • function.enchant-broker-request-dict.html
                                • function.enchant-broker-request-pwl-dict.html
                                • function.enchant-broker-set-dict-path.html
                                • function.enchant-broker-set-ordering.html
                                • function.enchant-dict-add-to-personal.html
                                • function.enchant-dict-add-to-session.html
                                • function.enchant-dict-check.html
                                • function.enchant-dict-describe.html
                                • function.enchant-dict-get-error.html
                                • function.enchant-dict-is-in-session.html
                                • function.enchant-dict-quick-check.html
                                • function.enchant-dict-store-replacement.html
                                • function.enchant-dict-suggest.html
                                • function.end.html
                                • function.ereg-replace.html
                                • function.ereg.html
                                • function.eregi-replace.html
                                • function.eregi.html
                                • function.error-clear-last.html
                                • function.error-get-last.html
                                • function.error-log.html
                                • function.error-reporting.html
                                • function.escapeshellarg.html
                                • function.escapeshellcmd.html
                                • function.eval.html
                                • function.event-add.html
                                • function.event-base-free.html
                                • function.event-base-loop.html
                                • function.event-base-loopbreak.html
                                • function.event-base-loopexit.html
                                • function.event-base-new.html
                                • function.event-base-priority-init.html
                                • function.event-base-reinit.html
                                • function.event-base-set.html
                                • function.event-buffer-base-set.html
                                • function.event-buffer-disable.html
                                • function.event-buffer-enable.html
                                • function.event-buffer-fd-set.html
                                • function.event-buffer-free.html
                                • function.event-buffer-new.html
                                • function.event-buffer-priority-set.html
                                • function.event-buffer-read.html
                                • function.event-buffer-set-callback.html
                                • function.event-buffer-timeout-set.html
                                • function.event-buffer-watermark-set.html
                                • function.event-buffer-write.html
                                • function.event-del.html
                                • function.event-free.html
                                • function.event-new.html
                                • function.event-priority-set.html
                                • function.event-set.html
                                • function.event-timer-add.html
                                • function.event-timer-del.html
                                • function.event-timer-new.html
                                • function.event-timer-set.html
                                • function.exec.html
                                • function.exif-imagetype.html
                                • function.exif-read-data.html
                                • function.exif-tagname.html
                                • function.exif-thumbnail.html
                                • function.exit.html
                                • function.exp.html
                                • function.expect-expectl.html
                                • function.expect-popen.html
                                • function.explode.html
                                • function.expm1.html
                                • function.extension-loaded.html
                                • function.extract.html
                                • function.ezmlm-hash.html
                                • function.fam-cancel-monitor.html
                                • function.fam-close.html
                                • function.fam-monitor-collection.html
                                • function.fam-monitor-directory.html
                                • function.fam-monitor-file.html
                                • function.fam-next-event.html
                                • function.fam-open.html
                                • function.fam-pending.html
                                • function.fam-resume-monitor.html
                                • function.fam-suspend-monitor.html
                                • function.fann-cascadetrain-on-data.html
                                • function.fann-cascadetrain-on-file.html
                                • function.fann-clear-scaling-params.html
                                • function.fann-copy.html
                                • function.fann-create-from-file.html
                                • function.fann-create-shortcut-array.html
                                • function.fann-create-shortcut.html
                                • function.fann-create-sparse-array.html
                                • function.fann-create-sparse.html
                                • function.fann-create-standard-array.html
                                • function.fann-create-standard.html
                                • function.fann-create-train-from-callback.html
                                • function.fann-create-train.html
                                • function.fann-descale-input.html
                                • function.fann-descale-output.html
                                • function.fann-descale-train.html
                                • function.fann-destroy-train.html
                                • function.fann-destroy.html
                                • function.fann-duplicate-train-data.html
                                • function.fann-get-activation-function.html
                                • function.fann-get-activation-steepness.html
                                • function.fann-get-bias-array.html
                                • function.fann-get-bit-fail-limit.html
                                • function.fann-get-bit-fail.html
                                • function.fann-get-cascade-activation-functions-count.html
                                • function.fann-get-cascade-activation-functions.html
                                • function.fann-get-cascade-activation-steepnesses-count.html
                                • function.fann-get-cascade-activation-steepnesses.html
                                • function.fann-get-cascade-candidate-change-fraction.html
                                • function.fann-get-cascade-candidate-limit.html
                                • function.fann-get-cascade-candidate-stagnation-epochs.html
                                • function.fann-get-cascade-max-cand-epochs.html
                                • function.fann-get-cascade-max-out-epochs.html
                                • function.fann-get-cascade-min-cand-epochs.html
                                • function.fann-get-cascade-min-out-epochs.html
                                • function.fann-get-cascade-num-candidate-groups.html
                                • function.fann-get-cascade-num-candidates.html
                                • function.fann-get-cascade-output-change-fraction.html
                                • function.fann-get-cascade-output-stagnation-epochs.html
                                • function.fann-get-cascade-weight-multiplier.html
                                • function.fann-get-connection-array.html
                                • function.fann-get-connection-rate.html
                                • function.fann-get-errno.html
                                • function.fann-get-errstr.html
                                • function.fann-get-layer-array.html
                                • function.fann-get-learning-momentum.html
                                • function.fann-get-learning-rate.html
                                • function.fann-get-mse.html
                                • function.fann-get-network-type.html
                                • function.fann-get-num-input.html
                                • function.fann-get-num-layers.html
                                • function.fann-get-num-output.html
                                • function.fann-get-quickprop-decay.html
                                • function.fann-get-quickprop-mu.html
                                • function.fann-get-rprop-decrease-factor.html
                                • function.fann-get-rprop-delta-max.html
                                • function.fann-get-rprop-delta-min.html
                                • function.fann-get-rprop-delta-zero.html
                                • function.fann-get-rprop-increase-factor.html
                                • function.fann-get-sarprop-step-error-shift.html
                                • function.fann-get-sarprop-step-error-threshold-factor.html
                                • function.fann-get-sarprop-temperature.html
                                • function.fann-get-sarprop-weight-decay-shift.html
                                • function.fann-get-total-connections.html
                                • function.fann-get-total-neurons.html
                                • function.fann-get-train-error-function.html
                                • function.fann-get-train-stop-function.html
                                • function.fann-get-training-algorithm.html
                                • function.fann-init-weights.html
                                • function.fann-length-train-data.html
                                • function.fann-merge-train-data.html
                                • function.fann-num-input-train-data.html
                                • function.fann-num-output-train-data.html
                                • function.fann-print-error.html
                                • function.fann-randomize-weights.html
                                • function.fann-read-train-from-file.html
                                • function.fann-reset-errno.html
                                • function.fann-reset-errstr.html
                                • function.fann-reset-mse.html
                                • function.fann-run.html
                                • function.fann-save-train.html
                                • function.fann-save.html
                                • function.fann-scale-input-train-data.html
                                • function.fann-scale-input.html
                                • function.fann-scale-output-train-data.html
                                • function.fann-scale-output.html
                                • function.fann-scale-train-data.html
                                • function.fann-scale-train.html
                                • function.fann-set-activation-function-hidden.html
                                • function.fann-set-activation-function-layer.html
                                • function.fann-set-activation-function-output.html
                                • function.fann-set-activation-function.html
                                • function.fann-set-activation-steepness-hidden.html
                                • function.fann-set-activation-steepness-layer.html
                                • function.fann-set-activation-steepness-output.html
                                • function.fann-set-activation-steepness.html
                                • function.fann-set-bit-fail-limit.html
                                • function.fann-set-callback.html
                                • function.fann-set-cascade-activation-functions.html
                                • function.fann-set-cascade-activation-steepnesses.html
                                • function.fann-set-cascade-candidate-change-fraction.html
                                • function.fann-set-cascade-candidate-limit.html
                                • function.fann-set-cascade-candidate-stagnation-epochs.html
                                • function.fann-set-cascade-max-cand-epochs.html
                                • function.fann-set-cascade-max-out-epochs.html
                                • function.fann-set-cascade-min-cand-epochs.html
                                • function.fann-set-cascade-min-out-epochs.html
                                • function.fann-set-cascade-num-candidate-groups.html
                                • function.fann-set-cascade-output-change-fraction.html
                                • function.fann-set-cascade-output-stagnation-epochs.html
                                • function.fann-set-cascade-weight-multiplier.html
                                • function.fann-set-error-log.html
                                • function.fann-set-input-scaling-params.html
                                • function.fann-set-learning-momentum.html
                                • function.fann-set-learning-rate.html
                                • function.fann-set-output-scaling-params.html
                                • function.fann-set-quickprop-decay.html
                                • function.fann-set-quickprop-mu.html
                                • function.fann-set-rprop-decrease-factor.html
                                • function.fann-set-rprop-delta-max.html
                                • function.fann-set-rprop-delta-min.html
                                • function.fann-set-rprop-delta-zero.html
                                • function.fann-set-rprop-increase-factor.html
                                • function.fann-set-sarprop-step-error-shift.html
                                • function.fann-set-sarprop-step-error-threshold-factor.html
                                • function.fann-set-sarprop-temperature.html
                                • function.fann-set-sarprop-weight-decay-shift.html
                                • function.fann-set-scaling-params.html
                                • function.fann-set-train-error-function.html
                                • function.fann-set-train-stop-function.html
                                • function.fann-set-training-algorithm.html
                                • function.fann-set-weight-array.html
                                • function.fann-set-weight.html
                                • function.fann-shuffle-train-data.html
                                • function.fann-subset-train-data.html
                                • function.fann-test-data.html
                                • function.fann-test.html
                                • function.fann-train-epoch.html
                                • function.fann-train-on-data.html
                                • function.fann-train-on-file.html
                                • function.fann-train.html
                                • function.fastcgi-finish-request.html
                                • function.fbsql-affected-rows.html
                                • function.fbsql-autocommit.html
                                • function.fbsql-blob-size.html
                                • function.fbsql-change-user.html
                                • function.fbsql-clob-size.html
                                • function.fbsql-close.html
                                • function.fbsql-commit.html
                                • function.fbsql-connect.html
                                • function.fbsql-create-blob.html
                                • function.fbsql-create-clob.html
                                • function.fbsql-create-db.html
                                • function.fbsql-data-seek.html
                                • function.fbsql-database-password.html
                                • function.fbsql-database.html
                                • function.fbsql-db-query.html
                                • function.fbsql-db-status.html
                                • function.fbsql-drop-db.html
                                • function.fbsql-errno.html
                                • function.fbsql-error.html
                                • function.fbsql-fetch-array.html
                                • function.fbsql-fetch-assoc.html
                                • function.fbsql-fetch-field.html
                                • function.fbsql-fetch-lengths.html
                                • function.fbsql-fetch-object.html
                                • function.fbsql-fetch-row.html
                                • function.fbsql-field-flags.html
                                • function.fbsql-field-len.html
                                • function.fbsql-field-name.html
                                • function.fbsql-field-seek.html
                                • function.fbsql-field-table.html
                                • function.fbsql-field-type.html
                                • function.fbsql-free-result.html
                                • function.fbsql-get-autostart-info.html
                                • function.fbsql-hostname.html
                                • function.fbsql-insert-id.html
                                • function.fbsql-list-dbs.html
                                • function.fbsql-list-fields.html
                                • function.fbsql-list-tables.html
                                • function.fbsql-next-result.html
                                • function.fbsql-num-fields.html
                                • function.fbsql-num-rows.html
                                • function.fbsql-password.html
                                • function.fbsql-pconnect.html
                                • function.fbsql-query.html
                                • function.fbsql-read-blob.html
                                • function.fbsql-read-clob.html
                                • function.fbsql-result.html
                                • function.fbsql-rollback.html
                                • function.fbsql-rows-fetched.html
                                • function.fbsql-select-db.html
                                • function.fbsql-set-characterset.html
                                • function.fbsql-set-lob-mode.html
                                • function.fbsql-set-password.html
                                • function.fbsql-set-transaction.html
                                • function.fbsql-start-db.html
                                • function.fbsql-stop-db.html
                                • function.fbsql-table-name.html
                                • function.fbsql-tablename.html
                                • function.fbsql-username.html
                                • function.fbsql-warnings.html
                                • function.fclose.html
                                • function.fdf-add-doc-javascript.html
                                • function.fdf-add-template.html
                                • function.fdf-close.html
                                • function.fdf-create.html
                                • function.fdf-enum-values.html
                                • function.fdf-errno.html
                                • function.fdf-error.html
                                • function.fdf-get-ap.html
                                • function.fdf-get-attachment.html
                                • function.fdf-get-encoding.html
                                • function.fdf-get-file.html
                                • function.fdf-get-flags.html
                                • function.fdf-get-opt.html
                                • function.fdf-get-status.html
                                • function.fdf-get-value.html
                                • function.fdf-get-version.html
                                • function.fdf-header.html
                                • function.fdf-next-field-name.html
                                • function.fdf-open-string.html
                                • function.fdf-open.html
                                • function.fdf-remove-item.html
                                • function.fdf-save-string.html
                                • function.fdf-save.html
                                • function.fdf-set-ap.html
                                • function.fdf-set-encoding.html
                                • function.fdf-set-file.html
                                • function.fdf-set-flags.html
                                • function.fdf-set-javascript-action.html
                                • function.fdf-set-on-import-javascript.html
                                • function.fdf-set-opt.html
                                • function.fdf-set-status.html
                                • function.fdf-set-submit-form-action.html
                                • function.fdf-set-target-frame.html
                                • function.fdf-set-value.html
                                • function.fdf-set-version.html
                                • function.feof.html
                                • function.fflush.html
                                • function.fgetc.html
                                • function.fgetcsv.html
                                • function.fgets.html
                                • function.fgetss.html
                                • function.file-exists.html
                                • function.file-get-contents.html
                                • function.file-put-contents.html
                                • function.file.html
                                • function.fileatime.html
                                • function.filectime.html
                                • function.filegroup.html
                                • function.fileinode.html
                                • function.filemtime.html
                                • function.fileowner.html
                                • function.fileperms.html
                                • function.filepro-fieldcount.html
                                • function.filepro-fieldname.html
                                • function.filepro-fieldtype.html
                                • function.filepro-fieldwidth.html
                                • function.filepro-retrieve.html
                                • function.filepro-rowcount.html
                                • function.filepro.html
                                • function.filesize.html
                                • function.filetype.html
                                • function.filter-has-var.html
                                • function.filter-id.html
                                • function.filter-input-array.html
                                • function.filter-input.html
                                • function.filter-list.html
                                • function.filter-var-array.html
                                • function.filter-var.html
                                • function.finfo-buffer.html
                                • function.finfo-close.html
                                • function.finfo-file.html
                                • function.finfo-open.html
                                • function.finfo-set-flags.html
                                • function.floatval.html
                                • function.flock.html
                                • function.floor.html
                                • function.flush.html
                                • function.fmod.html
                                • function.fnmatch.html
                                • function.fopen.html
                                • function.forward-static-call-array.html
                                • function.forward-static-call.html
                                • function.fpassthru.html
                                • function.fprintf.html
                                • function.fputcsv.html
                                • function.fputs.html
                                • function.fread.html
                                • function.frenchtojd.html
                                • function.fribidi-log2vis.html
                                • function.fscanf.html
                                • function.fseek.html
                                • function.fsockopen.html
                                • function.fstat.html
                                • function.ftell.html
                                • function.ftok.html
                                • function.ftp-alloc.html
                                • function.ftp-cdup.html
                                • function.ftp-chdir.html
                                • function.ftp-chmod.html
                                • function.ftp-close.html
                                • function.ftp-connect.html
                                • function.ftp-delete.html
                                • function.ftp-exec.html
                                • function.ftp-fget.html
                                • function.ftp-fput.html
                                • function.ftp-get-option.html
                                • function.ftp-get.html
                                • function.ftp-login.html
                                • function.ftp-mdtm.html
                                • function.ftp-mkdir.html
                                • function.ftp-nb-continue.html
                                • function.ftp-nb-fget.html
                                • function.ftp-nb-fput.html
                                • function.ftp-nb-get.html
                                • function.ftp-nb-put.html
                                • function.ftp-nlist.html
                                • function.ftp-pasv.html
                                • function.ftp-put.html
                                • function.ftp-pwd.html
                                • function.ftp-quit.html
                                • function.ftp-raw.html
                                • function.ftp-rawlist.html
                                • function.ftp-rename.html
                                • function.ftp-rmdir.html
                                • function.ftp-set-option.html
                                • function.ftp-site.html
                                • function.ftp-size.html
                                • function.ftp-ssl-connect.html
                                • function.ftp-systype.html
                                • function.ftruncate.html
                                • function.func-get-arg.html
                                • function.func-get-args.html
                                • function.func-num-args.html
                                • function.function-exists.html
                                • function.fwrite.html
                                • function.gc-collect-cycles.html
                                • function.gc-disable.html
                                • function.gc-enable.html
                                • function.gc-enabled.html
                                • function.gc-mem-caches.html
                                • function.gd-info.html
                                • function.geoip-asnum-by-name.html
                                • function.geoip-continent-code-by-name.html
                                • function.geoip-country-code-by-name.html
                                • function.geoip-country-code3-by-name.html
                                • function.geoip-country-name-by-name.html
                                • function.geoip-database-info.html
                                • function.geoip-db-avail.html
                                • function.geoip-db-filename.html
                                • function.geoip-db-get-all-info.html
                                • function.geoip-domain-by-name.html
                                • function.geoip-id-by-name.html
                                • function.geoip-isp-by-name.html
                                • function.geoip-netspeedcell-by-name.html
                                • function.geoip-org-by-name.html
                                • function.geoip-record-by-name.html
                                • function.geoip-region-by-name.html
                                • function.geoip-region-name-by-code.html
                                • function.geoip-setup-custom-directory.html
                                • function.geoip-time-zone-by-country-and-region.html
                                • function.get-browser.html
                                • function.get-called-class.html
                                • function.get-cfg-var.html
                                • function.get-class-methods.html
                                • function.get-class-vars.html
                                • function.get-class.html
                                • function.get-current-user.html
                                • function.get-declared-classes.html
                                • function.get-declared-interfaces.html
                                • function.get-declared-traits.html
                                • function.get-defined-constants.html
                                • function.get-defined-functions.html
                                • function.get-defined-vars.html
                                • function.get-extension-funcs.html
                                • function.get-headers.html
                                • function.get-html-translation-table.html
                                • function.get-include-path.html
                                • function.get-included-files.html
                                • function.get-loaded-extensions.html
                                • function.get-magic-quotes-gpc.html
                                • function.get-magic-quotes-runtime.html
                                • function.get-meta-tags.html
                                • function.get-object-vars.html
                                • function.get-parent-class.html
                                • function.get-required-files.html
                                • function.get-resource-type.html
                                • function.get-resources.html
                                • function.getallheaders.html
                                • function.getcwd.html
                                • function.getdate.html
                                • function.getenv.html
                                • function.gethostbyaddr.html
                                • function.gethostbyname.html
                                • function.gethostbynamel.html
                                • function.gethostname.html
                                • function.getimagesize.html
                                • function.getimagesizefromstring.html
                                • function.getlastmod.html
                                • function.getmxrr.html
                                • function.getmygid.html
                                • function.getmyinode.html
                                • function.getmypid.html
                                • function.getmyuid.html
                                • function.getopt.html
                                • function.getprotobyname.html
                                • function.getprotobynumber.html
                                • function.getrandmax.html
                                • function.getrusage.html
                                • function.getservbyname.html
                                • function.getservbyport.html
                                • function.gettext.html
                                • function.gettimeofday.html
                                • function.gettype.html
                                • function.glob.html
                                • function.gmdate.html
                                • function.gmmktime.html
                                • function.gmp-abs.html
                                • function.gmp-add.html
                                • function.gmp-and.html
                                • function.gmp-clrbit.html
                                • function.gmp-cmp.html
                                • function.gmp-com.html
                                • function.gmp-div-q.html
                                • function.gmp-div-qr.html
                                • function.gmp-div-r.html
                                • function.gmp-div.html
                                • function.gmp-divexact.html
                                • function.gmp-export.html
                                • function.gmp-fact.html
                                • function.gmp-gcd.html
                                • function.gmp-gcdext.html
                                • function.gmp-hamdist.html
                                • function.gmp-import.html
                                • function.gmp-init.html
                                • function.gmp-intval.html
                                • function.gmp-invert.html
                                • function.gmp-jacobi.html
                                • function.gmp-legendre.html
                                • function.gmp-mod.html
                                • function.gmp-mul.html
                                • function.gmp-neg.html
                                • function.gmp-nextprime.html
                                • function.gmp-or.html
                                • function.gmp-perfect-square.html
                                • function.gmp-popcount.html
                                • function.gmp-pow.html
                                • function.gmp-powm.html
                                • function.gmp-prob-prime.html
                                • function.gmp-random-bits.html
                                • function.gmp-random-range.html
                                • function.gmp-random-seed.html
                                • function.gmp-random.html
                                • function.gmp-root.html
                                • function.gmp-rootrem.html
                                • function.gmp-scan0.html
                                • function.gmp-scan1.html
                                • function.gmp-setbit.html
                                • function.gmp-sign.html
                                • function.gmp-sqrt.html
                                • function.gmp-sqrtrem.html
                                • function.gmp-strval.html
                                • function.gmp-sub.html
                                • function.gmp-testbit.html
                                • function.gmp-xor.html
                                • function.gmstrftime.html
                                • function.gnupg-adddecryptkey.html
                                • function.gnupg-addencryptkey.html
                                • function.gnupg-addsignkey.html
                                • function.gnupg-cleardecryptkeys.html
                                • function.gnupg-clearencryptkeys.html
                                • function.gnupg-clearsignkeys.html
                                • function.gnupg-decrypt.html
                                • function.gnupg-decryptverify.html
                                • function.gnupg-encrypt.html
                                • function.gnupg-encryptsign.html
                                • function.gnupg-export.html
                                • function.gnupg-geterror.html
                                • function.gnupg-getprotocol.html
                                • function.gnupg-import.html
                                • function.gnupg-init.html
                                • function.gnupg-keyinfo.html
                                • function.gnupg-setarmor.html
                                • function.gnupg-seterrormode.html
                                • function.gnupg-setsignmode.html
                                • function.gnupg-sign.html
                                • function.gnupg-verify.html
                                • function.gopher-parsedir.html
                                • function.grapheme-extract.html
                                • function.grapheme-stripos.html
                                • function.grapheme-stristr.html
                                • function.grapheme-strlen.html
                                • function.grapheme-strpos.html
                                • function.grapheme-strripos.html
                                • function.grapheme-strrpos.html
                                • function.grapheme-strstr.html
                                • function.grapheme-substr.html
                                • function.gregoriantojd.html
                                • function.gupnp-context-get-host-ip.html
                                • function.gupnp-context-get-port.html
                                • function.gupnp-context-get-subscription-timeout.html
                                • function.gupnp-context-host-path.html
                                • function.gupnp-context-new.html
                                • function.gupnp-context-set-subscription-timeout.html
                                • function.gupnp-context-timeout-add.html
                                • function.gupnp-context-unhost-path.html
                                • function.gupnp-control-point-browse-start.html
                                • function.gupnp-control-point-browse-stop.html
                                • function.gupnp-control-point-callback-set.html
                                • function.gupnp-control-point-new.html
                                • function.gupnp-device-action-callback-set.html
                                • function.gupnp-device-info-get-service.html
                                • function.gupnp-device-info-get.html
                                • function.gupnp-root-device-get-available.html
                                • function.gupnp-root-device-get-relative-location.html
                                • function.gupnp-root-device-new.html
                                • function.gupnp-root-device-set-available.html
                                • function.gupnp-root-device-start.html
                                • function.gupnp-root-device-stop.html
                                • function.gupnp-service-action-get.html
                                • function.gupnp-service-action-return-error.html
                                • function.gupnp-service-action-return.html
                                • function.gupnp-service-action-set.html
                                • function.gupnp-service-freeze-notify.html
                                • function.gupnp-service-info-get-introspection.html
                                • function.gupnp-service-info-get.html
                                • function.gupnp-service-introspection-get-state-variable.html
                                • function.gupnp-service-notify.html
                                • function.gupnp-service-proxy-action-get.html
                                • function.gupnp-service-proxy-action-set.html
                                • function.gupnp-service-proxy-add-notify.html
                                • function.gupnp-service-proxy-callback-set.html
                                • function.gupnp-service-proxy-get-subscribed.html
                                • function.gupnp-service-proxy-remove-notify.html
                                • function.gupnp-service-proxy-set-subscribed.html
                                • function.gupnp-service-thaw-notify.html
                                • function.gzclose.html
                                • function.gzcompress.html
                                • function.gzdecode.html
                                • function.gzdeflate.html
                                • function.gzencode.html
                                • function.gzeof.html
                                • function.gzfile.html
                                • function.gzgetc.html
                                • function.gzgets.html
                                • function.gzgetss.html
                                • function.gzinflate.html
                                • function.gzopen.html
                                • function.gzpassthru.html
                                • function.gzputs.html
                                • function.gzread.html
                                • function.gzrewind.html
                                • function.gzseek.html
                                • function.gztell.html
                                • function.gzuncompress.html
                                • function.gzwrite.html
                                • function.halt-compiler.html
                                • function.hash-algos.html
                                • function.hash-copy.html
                                • function.hash-equals.html
                                • function.hash-file.html
                                • function.hash-final.html
                                • function.hash-hmac-file.html
                                • function.hash-hmac.html
                                • function.hash-init.html
                                • function.hash-pbkdf2.html
                                • function.hash-update-file.html
                                • function.hash-update-stream.html
                                • function.hash-update.html
                                • function.hash.html
                                • function.header-register-callback.html
                                • function.header-remove.html
                                • function.header.html
                                • function.headers-list.html
                                • function.headers-sent.html
                                • function.hebrev.html
                                • function.hebrevc.html
                                • function.hex2bin.html
                                • function.hexdec.html
                                • function.highlight-file.html
                                • function.highlight-string.html
                                • function.html-entity-decode.html
                                • function.htmlentities.html
                                • function.htmlspecialchars-decode.html
                                • function.htmlspecialchars.html
                                • function.http-build-cookie.html
                                • function.http-build-query.html
                                • function.http-build-str.html
                                • function.http-build-url.html
                                • function.http-cache-etag.html
                                • function.http-cache-last-modified.html
                                • function.http-chunked-decode.html
                                • function.http-date.html
                                • function.http-deflate.html
                                • function.http-get-request-body-stream.html
                                • function.http-get-request-body.html
                                • function.http-get-request-headers.html
                                • function.http-get.html
                                • function.http-head.html
                                • function.http-inflate.html
                                • function.http-match-etag.html
                                • function.http-match-modified.html
                                • function.http-match-request-header.html
                                • function.http-negotiate-charset.html
                                • function.http-negotiate-content-type.html
                                • function.http-negotiate-language.html
                                • function.http-parse-cookie.html
                                • function.http-parse-headers.html
                                • function.http-parse-message.html
                                • function.http-parse-params.html
                                • function.http-persistent-handles-clean.html
                                • function.http-persistent-handles-count.html
                                • function.http-persistent-handles-ident.html
                                • function.http-post-data.html
                                • function.http-post-fields.html
                                • function.http-put-data.html
                                • function.http-put-file.html
                                • function.http-put-stream.html
                                • function.http-redirect.html
                                • function.http-request-body-encode.html
                                • function.http-request-method-exists.html
                                • function.http-request-method-name.html
                                • function.http-request-method-register.html
                                • function.http-request-method-unregister.html
                                • function.http-request.html
                                • function.http-response-code.html
                                • function.http-send-content-disposition.html
                                • function.http-send-content-type.html
                                • function.http-send-data.html
                                • function.http-send-file.html
                                • function.http-send-last-modified.html
                                • function.http-send-status.html
                                • function.http-send-stream.html
                                • function.http-support.html
                                • function.http-throttle.html
                                • function.hwapi-attribute-new.html
                                • function.hwapi-content-new.html
                                • function.hwapi-hgcsp.html
                                • function.hwapi-object-new.html
                                • function.hypot.html
                                • function.ibase-add-user.html
                                • function.ibase-affected-rows.html
                                • function.ibase-backup.html
                                • function.ibase-blob-add.html
                                • function.ibase-blob-cancel.html
                                • function.ibase-blob-close.html
                                • function.ibase-blob-create.html
                                • function.ibase-blob-echo.html
                                • function.ibase-blob-get.html
                                • function.ibase-blob-import.html
                                • function.ibase-blob-info.html
                                • function.ibase-blob-open.html
                                • function.ibase-close.html
                                • function.ibase-commit-ret.html
                                • function.ibase-commit.html
                                • function.ibase-connect.html
                                • function.ibase-db-info.html
                                • function.ibase-delete-user.html
                                • function.ibase-drop-db.html
                                • function.ibase-errcode.html
                                • function.ibase-errmsg.html
                                • function.ibase-execute.html
                                • function.ibase-fetch-assoc.html
                                • function.ibase-fetch-object.html
                                • function.ibase-fetch-row.html
                                • function.ibase-field-info.html
                                • function.ibase-free-event-handler.html
                                • function.ibase-free-query.html
                                • function.ibase-free-result.html
                                • function.ibase-gen-id.html
                                • function.ibase-maintain-db.html
                                • function.ibase-modify-user.html
                                • function.ibase-name-result.html
                                • function.ibase-num-fields.html
                                • function.ibase-num-params.html
                                • function.ibase-param-info.html
                                • function.ibase-pconnect.html
                                • function.ibase-prepare.html
                                • function.ibase-query.html
                                • function.ibase-restore.html
                                • function.ibase-rollback-ret.html
                                • function.ibase-rollback.html
                                • function.ibase-server-info.html
                                • function.ibase-service-attach.html
                                • function.ibase-service-detach.html
                                • function.ibase-set-event-handler.html
                                • function.ibase-trans.html
                                • function.ibase-wait-event.html
                                • function.iconv-get-encoding.html
                                • function.iconv-mime-decode-headers.html
                                • function.iconv-mime-decode.html
                                • function.iconv-mime-encode.html
                                • function.iconv-set-encoding.html
                                • function.iconv-strlen.html
                                • function.iconv-strpos.html
                                • function.iconv-strrpos.html
                                • function.iconv-substr.html
                                • function.iconv.html
                                • function.id3-get-frame-long-name.html
                                • function.id3-get-frame-short-name.html
                                • function.id3-get-genre-id.html
                                • function.id3-get-genre-list.html
                                • function.id3-get-genre-name.html
                                • function.id3-get-tag.html
                                • function.id3-get-version.html
                                • function.id3-remove-tag.html
                                • function.id3-set-tag.html
                                • function.idate.html
                                • function.idn-to-ascii.html
                                • function.idn-to-unicode.html
                                • function.idn-to-utf8.html
                                • function.ifx-affected-rows.html
                                • function.ifx-blobinfile-mode.html
                                • function.ifx-byteasvarchar.html
                                • function.ifx-close.html
                                • function.ifx-connect.html
                                • function.ifx-copy-blob.html
                                • function.ifx-create-blob.html
                                • function.ifx-create-char.html
                                • function.ifx-do.html
                                • function.ifx-error.html
                                • function.ifx-errormsg.html
                                • function.ifx-fetch-row.html
                                • function.ifx-fieldproperties.html
                                • function.ifx-fieldtypes.html
                                • function.ifx-free-blob.html
                                • function.ifx-free-char.html
                                • function.ifx-free-result.html
                                • function.ifx-get-blob.html
                                • function.ifx-get-char.html
                                • function.ifx-getsqlca.html
                                • function.ifx-htmltbl-result.html
                                • function.ifx-nullformat.html
                                • function.ifx-num-fields.html
                                • function.ifx-num-rows.html
                                • function.ifx-pconnect.html
                                • function.ifx-prepare.html
                                • function.ifx-query.html
                                • function.ifx-textasvarchar.html
                                • function.ifx-update-blob.html
                                • function.ifx-update-char.html
                                • function.ifxus-close-slob.html
                                • function.ifxus-create-slob.html
                                • function.ifxus-free-slob.html
                                • function.ifxus-open-slob.html
                                • function.ifxus-read-slob.html
                                • function.ifxus-seek-slob.html
                                • function.ifxus-tell-slob.html
                                • function.ifxus-write-slob.html
                                • function.ignore-user-abort.html
                                • function.iis-add-server.html
                                • function.iis-get-dir-security.html
                                • function.iis-get-script-map.html
                                • function.iis-get-server-by-comment.html
                                • function.iis-get-server-by-path.html
                                • function.iis-get-server-rights.html
                                • function.iis-get-service-state.html
                                • function.iis-remove-server.html
                                • function.iis-set-app-settings.html
                                • function.iis-set-dir-security.html
                                • function.iis-set-script-map.html
                                • function.iis-set-server-rights.html
                                • function.iis-start-server.html
                                • function.iis-start-service.html
                                • function.iis-stop-server.html
                                • function.iis-stop-service.html
                                • function.image-type-to-extension.html
                                • function.image-type-to-mime-type.html
                                • function.image2wbmp.html
                                • function.imageaffine.html
                                • function.imageaffinematrixconcat.html
                                • function.imageaffinematrixget.html
                                • function.imagealphablending.html
                                • function.imageantialias.html
                                • function.imagearc.html
                                • function.imagechar.html
                                • function.imagecharup.html
                                • function.imagecolorallocate.html
                                • function.imagecolorallocatealpha.html
                                • function.imagecolorat.html
                                • function.imagecolorclosest.html
                                • function.imagecolorclosestalpha.html
                                • function.imagecolorclosesthwb.html
                                • function.imagecolordeallocate.html
                                • function.imagecolorexact.html
                                • function.imagecolorexactalpha.html
                                • function.imagecolormatch.html
                                • function.imagecolorresolve.html
                                • function.imagecolorresolvealpha.html
                                • function.imagecolorset.html
                                • function.imagecolorsforindex.html
                                • function.imagecolorstotal.html
                                • function.imagecolortransparent.html
                                • function.imageconvolution.html
                                • function.imagecopy.html
                                • function.imagecopymerge.html
                                • function.imagecopymergegray.html
                                • function.imagecopyresampled.html
                                • function.imagecopyresized.html
                                • function.imagecreate.html
                                • function.imagecreatefromgd.html
                                • function.imagecreatefromgd2.html
                                • function.imagecreatefromgd2part.html
                                • function.imagecreatefromgif.html
                                • function.imagecreatefromjpeg.html
                                • function.imagecreatefrompng.html
                                • function.imagecreatefromstring.html
                                • function.imagecreatefromwbmp.html
                                • function.imagecreatefromwebp.html
                                • function.imagecreatefromxbm.html
                                • function.imagecreatefromxpm.html
                                • function.imagecreatetruecolor.html
                                • function.imagecrop.html
                                • function.imagecropauto.html
                                • function.imagedashedline.html
                                • function.imagedestroy.html
                                • function.imageellipse.html
                                • function.imagefill.html
                                • function.imagefilledarc.html
                                • function.imagefilledellipse.html
                                • function.imagefilledpolygon.html
                                • function.imagefilledrectangle.html
                                • function.imagefilltoborder.html
                                • function.imagefilter.html
                                • function.imageflip.html
                                • function.imagefontheight.html
                                • function.imagefontwidth.html
                                • function.imageftbbox.html
                                • function.imagefttext.html
                                • function.imagegammacorrect.html
                                • function.imagegd.html
                                • function.imagegd2.html
                                • function.imagegif.html
                                • function.imagegrabscreen.html
                                • function.imagegrabwindow.html
                                • function.imageinterlace.html
                                • function.imageistruecolor.html
                                • function.imagejpeg.html
                                • function.imagelayereffect.html
                                • function.imageline.html
                                • function.imageloadfont.html
                                • function.imagepalettecopy.html
                                • function.imagepalettetotruecolor.html
                                • function.imagepng.html
                                • function.imagepolygon.html
                                • function.imagepsbbox.html
                                • function.imagepsencodefont.html
                                • function.imagepsextendfont.html
                                • function.imagepsfreefont.html
                                • function.imagepsloadfont.html
                                • function.imagepsslantfont.html
                                • function.imagepstext.html
                                • function.imagerectangle.html
                                • function.imagerotate.html
                                • function.imagesavealpha.html
                                • function.imagescale.html
                                • function.imagesetbrush.html
                                • function.imagesetinterpolation.html
                                • function.imagesetpixel.html
                                • function.imagesetstyle.html
                                • function.imagesetthickness.html
                                • function.imagesettile.html
                                • function.imagestring.html
                                • function.imagestringup.html
                                • function.imagesx.html
                                • function.imagesy.html
                                • function.imagetruecolortopalette.html
                                • function.imagettfbbox.html
                                • function.imagettftext.html
                                • function.imagetypes.html
                                • function.imagewbmp.html
                                • function.imagewebp.html
                                • function.imagexbm.html
                                • function.imap-8bit.html
                                • function.imap-alerts.html
                                • function.imap-append.html
                                • function.imap-base64.html
                                • function.imap-binary.html
                                • function.imap-body.html
                                • function.imap-bodystruct.html
                                • function.imap-check.html
                                • function.imap-clearflag-full.html
                                • function.imap-close.html
                                • function.imap-create.html
                                • function.imap-createmailbox.html
                                • function.imap-delete.html
                                • function.imap-deletemailbox.html
                                • function.imap-errors.html
                                • function.imap-expunge.html
                                • function.imap-fetch-overview.html
                                • function.imap-fetchbody.html
                                • function.imap-fetchheader.html
                                • function.imap-fetchmime.html
                                • function.imap-fetchstructure.html
                                • function.imap-fetchtext.html
                                • function.imap-gc.html
                                • function.imap-get-quota.html
                                • function.imap-get-quotaroot.html
                                • function.imap-getacl.html
                                • function.imap-getmailboxes.html
                                • function.imap-getsubscribed.html
                                • function.imap-header.html
                                • function.imap-headerinfo.html
                                • function.imap-headers.html
                                • function.imap-last-error.html
                                • function.imap-list.html
                                • function.imap-listmailbox.html
                                • function.imap-listscan.html
                                • function.imap-listsubscribed.html
                                • function.imap-lsub.html
                                • function.imap-mail-compose.html
                                • function.imap-mail-copy.html
                                • function.imap-mail-move.html
                                • function.imap-mail.html
                                • function.imap-mailboxmsginfo.html
                                • function.imap-mime-header-decode.html
                                • function.imap-msgno.html
                                • function.imap-num-msg.html
                                • function.imap-num-recent.html
                                • function.imap-open.html
                                • function.imap-ping.html
                                • function.imap-qprint.html
                                • function.imap-rename.html
                                • function.imap-renamemailbox.html
                                • function.imap-reopen.html
                                • function.imap-rfc822-parse-adrlist.html
                                • function.imap-rfc822-parse-headers.html
                                • function.imap-rfc822-write-address.html
                                • function.imap-savebody.html
                                • function.imap-scan.html
                                • function.imap-scanmailbox.html
                                • function.imap-search.html
                                • function.imap-set-quota.html
                                • function.imap-setacl.html
                                • function.imap-setflag-full.html
                                • function.imap-sort.html
                                • function.imap-status.html
                                • function.imap-subscribe.html
                                • function.imap-thread.html
                                • function.imap-timeout.html
                                • function.imap-uid.html
                                • function.imap-undelete.html
                                • function.imap-unsubscribe.html
                                • function.imap-utf7-decode.html
                                • function.imap-utf7-encode.html
                                • function.imap-utf8.html
                                • function.implode.html
                                • function.import-request-variables.html
                                • function.in-array.html
                                • function.include-once.html
                                • function.include.html
                                • function.inclued-get-data.html
                                • function.inet-ntop.html
                                • function.inet-pton.html
                                • function.ingres-autocommit-state.html
                                • function.ingres-autocommit.html
                                • function.ingres-charset.html
                                • function.ingres-close.html
                                • function.ingres-commit.html
                                • function.ingres-connect.html
                                • function.ingres-cursor.html
                                • function.ingres-errno.html
                                • function.ingres-error.html
                                • function.ingres-errsqlstate.html
                                • function.ingres-escape-string.html
                                • function.ingres-execute.html
                                • function.ingres-fetch-array.html
                                • function.ingres-fetch-assoc.html
                                • function.ingres-fetch-object.html
                                • function.ingres-fetch-proc-return.html
                                • function.ingres-fetch-row.html
                                • function.ingres-field-length.html
                                • function.ingres-field-name.html
                                • function.ingres-field-nullable.html
                                • function.ingres-field-precision.html
                                • function.ingres-field-scale.html
                                • function.ingres-field-type.html
                                • function.ingres-free-result.html
                                • function.ingres-next-error.html
                                • function.ingres-num-fields.html
                                • function.ingres-num-rows.html
                                • function.ingres-pconnect.html
                                • function.ingres-prepare.html
                                • function.ingres-query.html
                                • function.ingres-result-seek.html
                                • function.ingres-rollback.html
                                • function.ingres-set-environment.html
                                • function.ingres-unbuffered-query.html
                                • function.ini-alter.html
                                • function.ini-get-all.html
                                • function.ini-get.html
                                • function.ini-restore.html
                                • function.ini-set.html
                                • function.inotify-add-watch.html
                                • function.inotify-init.html
                                • function.inotify-queue-len.html
                                • function.inotify-read.html
                                • function.inotify-rm-watch.html
                                • function.intdiv.html
                                • function.interface-exists.html
                                • function.intl-error-name.html
                                • function.intl-get-error-code.html
                                • function.intl-get-error-message.html
                                • function.intl-is-failure.html
                                • function.intval.html
                                • function.ip2long.html
                                • function.iptcembed.html
                                • function.iptcparse.html
                                • function.is-a.html
                                • function.is-array.html
                                • function.is-bool.html
                                • function.is-callable.html
                                • function.is-dir.html
                                • function.is-double.html
                                • function.is-executable.html
                                • function.is-file.html
                                • function.is-finite.html
                                • function.is-float.html
                                • function.is-infinite.html
                                • function.is-int.html
                                • function.is-integer.html
                                • function.is-link.html
                                • function.is-long.html
                                • function.is-nan.html
                                • function.is-null.html
                                • function.is-numeric.html
                                • function.is-object.html
                                • function.is-readable.html
                                • function.is-real.html
                                • function.is-resource.html
                                • function.is-scalar.html
                                • function.is-soap-fault.html
                                • function.is-string.html
                                • function.is-subclass-of.html
                                • function.is-tainted.html
                                • function.is-uploaded-file.html
                                • function.is-writable.html
                                • function.is-writeable.html
                                • function.isset.html
                                • function.iterator-apply.html
                                • function.iterator-count.html
                                • function.iterator-to-array.html
                                • function.jddayofweek.html
                                • function.jdmonthname.html
                                • function.jdtofrench.html
                                • function.jdtogregorian.html
                                • function.jdtojewish.html
                                • function.jdtojulian.html
                                • function.jdtounix.html
                                • function.jewishtojd.html
                                • function.join.html
                                • function.jpeg2wbmp.html
                                • function.json-decode.html
                                • function.json-encode.html
                                • function.json-last-error-msg.html
                                • function.json-last-error.html
                                • function.judy-type.html
                                • function.judy-version.html
                                • function.juliantojd.html
                                • function.kadm5-chpass-principal.html
                                • function.kadm5-create-principal.html
                                • function.kadm5-delete-principal.html
                                • function.kadm5-destroy.html
                                • function.kadm5-flush.html
                                • function.kadm5-get-policies.html
                                • function.kadm5-get-principal.html
                                • function.kadm5-get-principals.html
                                • function.kadm5-init-with-password.html
                                • function.kadm5-modify-principal.html
                                • function.key-exists.html
                                • function.key.html
                                • function.krsort.html
                                • function.ksort.html
                                • function.lcfirst.html
                                • function.lcg-value.html
                                • function.lchgrp.html
                                • function.lchown.html
                                • function.ldap-8859-to-t61.html
                                • function.ldap-add.html
                                • function.ldap-bind.html
                                • function.ldap-close.html
                                • function.ldap-compare.html
                                • function.ldap-connect.html
                                • function.ldap-control-paged-result-response.html
                                • function.ldap-control-paged-result.html
                                • function.ldap-count-entries.html
                                • function.ldap-delete.html
                                • function.ldap-dn2ufn.html
                                • function.ldap-err2str.html
                                • function.ldap-errno.html
                                • function.ldap-error.html
                                • function.ldap-escape.html
                                • function.ldap-explode-dn.html
                                • function.ldap-first-attribute.html
                                • function.ldap-first-entry.html
                                • function.ldap-first-reference.html
                                • function.ldap-free-result.html
                                • function.ldap-get-attributes.html
                                • function.ldap-get-dn.html
                                • function.ldap-get-entries.html
                                • function.ldap-get-option.html
                                • function.ldap-get-values-len.html
                                • function.ldap-get-values.html
                                • function.ldap-list.html
                                • function.ldap-mod-add.html
                                • function.ldap-mod-del.html
                                • function.ldap-mod-replace.html
                                • function.ldap-modify-batch.html
                                • function.ldap-modify.html
                                • function.ldap-next-attribute.html
                                • function.ldap-next-entry.html
                                • function.ldap-next-reference.html
                                • function.ldap-parse-reference.html
                                • function.ldap-parse-result.html
                                • function.ldap-read.html
                                • function.ldap-rename.html
                                • function.ldap-sasl-bind.html
                                • function.ldap-search.html
                                • function.ldap-set-option.html
                                • function.ldap-set-rebind-proc.html
                                • function.ldap-sort.html
                                • function.ldap-start-tls.html
                                • function.ldap-t61-to-8859.html
                                • function.ldap-unbind.html
                                • function.levenshtein.html
                                • function.libxml-clear-errors.html
                                • function.libxml-disable-entity-loader.html
                                • function.libxml-get-errors.html
                                • function.libxml-get-last-error.html
                                • function.libxml-set-external-entity-loader.html
                                • function.libxml-set-streams-context.html
                                • function.libxml-use-internal-errors.html
                                • function.link.html
                                • function.linkinfo.html
                                • function.list.html
                                • function.localeconv.html
                                • function.localtime.html
                                • function.log-cmd-delete.html
                                • function.log-cmd-insert.html
                                • function.log-cmd-update.html
                                • function.log-getmore.html
                                • function.log-killcursor.html
                                • function.log-reply.html
                                • function.log-write-batch.html
                                • function.log.html
                                • function.log10.html
                                • function.log1p.html
                                • function.long2ip.html
                                • function.lstat.html
                                • function.ltrim.html
                                • function.lzf-compress.html
                                • function.lzf-decompress.html
                                • function.lzf-optimized-for.html
                                • function.m-checkstatus.html
                                • function.m-completeauthorizations.html
                                • function.m-connect.html
                                • function.m-connectionerror.html
                                • function.m-deletetrans.html
                                • function.m-destroyconn.html
                                • function.m-destroyengine.html
                                • function.m-getcell.html
                                • function.m-getcellbynum.html
                                • function.m-getcommadelimited.html
                                • function.m-getheader.html
                                • function.m-initconn.html
                                • function.m-initengine.html
                                • function.m-iscommadelimited.html
                                • function.m-maxconntimeout.html
                                • function.m-monitor.html
                                • function.m-numcolumns.html
                                • function.m-numrows.html
                                • function.m-parsecommadelimited.html
                                • function.m-responsekeys.html
                                • function.m-responseparam.html
                                • function.m-returnstatus.html
                                • function.m-setblocking.html
                                • function.m-setdropfile.html
                                • function.m-setip.html
                                • function.m-setssl-cafile.html
                                • function.m-setssl-files.html
                                • function.m-setssl.html
                                • function.m-settimeout.html
                                • function.m-sslcert-gen-hash.html
                                • function.m-transactionssent.html
                                • function.m-transinqueue.html
                                • function.m-transkeyval.html
                                • function.m-transnew.html
                                • function.m-transsend.html
                                • function.m-uwait.html
                                • function.m-validateidentifier.html
                                • function.m-verifyconnection.html
                                • function.m-verifysslcert.html
                                • function.magic-quotes-runtime.html
                                • function.mail.html
                                • function.mailparse-determine-best-xfer-encoding.html
                                • function.mailparse-msg-create.html
                                • function.mailparse-msg-extract-part-file.html
                                • function.mailparse-msg-extract-part.html
                                • function.mailparse-msg-extract-whole-part-file.html
                                • function.mailparse-msg-free.html
                                • function.mailparse-msg-get-part-data.html
                                • function.mailparse-msg-get-part.html
                                • function.mailparse-msg-get-structure.html
                                • function.mailparse-msg-parse-file.html
                                • function.mailparse-msg-parse.html
                                • function.mailparse-rfc822-parse-addresses.html
                                • function.mailparse-stream-encode.html
                                • function.mailparse-uudecode-all.html
                                • function.main.html
                                • function.max.html
                                • function.maxdb-affected-rows.html
                                • function.maxdb-autocommit.html
                                • function.maxdb-bind-param.html
                                • function.maxdb-bind-result.html
                                • function.maxdb-change-user.html
                                • function.maxdb-character-set-name.html
                                • function.maxdb-client-encoding.html
                                • function.maxdb-close-long-data.html
                                • function.maxdb-close.html
                                • function.maxdb-commit.html
                                • function.maxdb-connect-errno.html
                                • function.maxdb-connect-error.html
                                • function.maxdb-connect.html
                                • function.maxdb-data-seek.html
                                • function.maxdb-debug.html
                                • function.maxdb-disable-reads-from-master.html
                                • function.maxdb-disable-rpl-parse.html
                                • function.maxdb-dump-debug-info.html
                                • function.maxdb-embedded-connect.html
                                • function.maxdb-enable-reads-from-master.html
                                • function.maxdb-enable-rpl-parse.html
                                • function.maxdb-errno.html
                                • function.maxdb-error.html
                                • function.maxdb-escape-string.html
                                • function.maxdb-execute.html
                                • function.maxdb-fetch-array.html
                                • function.maxdb-fetch-assoc.html
                                • function.maxdb-fetch-field-direct.html
                                • function.maxdb-fetch-field.html
                                • function.maxdb-fetch-fields.html
                                • function.maxdb-fetch-lengths.html
                                • function.maxdb-fetch-object.html
                                • function.maxdb-fetch-row.html
                                • function.maxdb-fetch.html
                                • function.maxdb-field-count.html
                                • function.maxdb-field-seek.html
                                • function.maxdb-field-tell.html
                                • function.maxdb-free-result.html
                                • function.maxdb-get-client-info.html
                                • function.maxdb-get-client-version.html
                                • function.maxdb-get-host-info.html
                                • function.maxdb-get-metadata.html
                                • function.maxdb-get-proto-info.html
                                • function.maxdb-get-server-info.html
                                • function.maxdb-get-server-version.html
                                • function.maxdb-info.html
                                • function.maxdb-init.html
                                • function.maxdb-insert-id.html
                                • function.maxdb-kill.html
                                • function.maxdb-master-query.html
                                • function.maxdb-more-results.html
                                • function.maxdb-multi-query.html
                                • function.maxdb-next-result.html
                                • function.maxdb-num-fields.html
                                • function.maxdb-num-rows.html
                                • function.maxdb-options.html
                                • function.maxdb-param-count.html
                                • function.maxdb-ping.html
                                • function.maxdb-prepare.html
                                • function.maxdb-query.html
                                • function.maxdb-real-connect.html
                                • function.maxdb-real-escape-string.html
                                • function.maxdb-real-query.html
                                • function.maxdb-report.html
                                • function.maxdb-rollback.html
                                • function.maxdb-rpl-parse-enabled.html
                                • function.maxdb-rpl-probe.html
                                • function.maxdb-rpl-query-type.html
                                • function.maxdb-select-db.html
                                • function.maxdb-send-long-data.html
                                • function.maxdb-send-query.html
                                • function.maxdb-server-end.html
                                • function.maxdb-server-init.html
                                • function.maxdb-set-opt.html
                                • function.maxdb-sqlstate.html
                                • function.maxdb-ssl-set.html
                                • function.maxdb-stat.html
                                • function.maxdb-stmt-affected-rows.html
                                • function.maxdb-stmt-bind-param.html
                                • function.maxdb-stmt-bind-result.html
                                • function.maxdb-stmt-close-long-data.html
                                • function.maxdb-stmt-close.html
                                • function.maxdb-stmt-data-seek.html
                                • function.maxdb-stmt-errno.html
                                • function.maxdb-stmt-error.html
                                • function.maxdb-stmt-execute.html
                                • function.maxdb-stmt-fetch.html
                                • function.maxdb-stmt-free-result.html
                                • function.maxdb-stmt-init.html
                                • function.maxdb-stmt-num-rows.html
                                • function.maxdb-stmt-param-count.html
                                • function.maxdb-stmt-prepare.html
                                • function.maxdb-stmt-reset.html
                                • function.maxdb-stmt-result-metadata.html
                                • function.maxdb-stmt-send-long-data.html
                                • function.maxdb-stmt-sqlstate.html
                                • function.maxdb-stmt-store-result.html
                                • function.maxdb-store-result.html
                                • function.maxdb-thread-id.html
                                • function.maxdb-thread-safe.html
                                • function.maxdb-use-result.html
                                • function.maxdb-warning-count.html
                                • function.mb-check-encoding.html
                                • function.mb-convert-case.html
                                • function.mb-convert-encoding.html
                                • function.mb-convert-kana.html
                                • function.mb-convert-variables.html
                                • function.mb-decode-mimeheader.html
                                • function.mb-decode-numericentity.html
                                • function.mb-detect-encoding.html
                                • function.mb-detect-order.html
                                • function.mb-encode-mimeheader.html
                                • function.mb-encode-numericentity.html
                                • function.mb-encoding-aliases.html
                                • function.mb-ereg-match.html
                                • function.mb-ereg-replace-callback.html
                                • function.mb-ereg-replace.html
                                • function.mb-ereg-search-getpos.html
                                • function.mb-ereg-search-getregs.html
                                • function.mb-ereg-search-init.html
                                • function.mb-ereg-search-pos.html
                                • function.mb-ereg-search-regs.html
                                • function.mb-ereg-search-setpos.html
                                • function.mb-ereg-search.html
                                • function.mb-ereg.html
                                • function.mb-eregi-replace.html
                                • function.mb-eregi.html
                                • function.mb-get-info.html
                                • function.mb-http-input.html
                                • function.mb-http-output.html
                                • function.mb-internal-encoding.html
                                • function.mb-language.html
                                • function.mb-list-encodings.html
                                • function.mb-output-handler.html
                                • function.mb-parse-str.html
                                • function.mb-preferred-mime-name.html
                                • function.mb-regex-encoding.html
                                • function.mb-regex-set-options.html
                                • function.mb-send-mail.html
                                • function.mb-split.html
                                • function.mb-strcut.html
                                • function.mb-strimwidth.html
                                • function.mb-stripos.html
                                • function.mb-stristr.html
                                • function.mb-strlen.html
                                • function.mb-strpos.html
                                • function.mb-strrchr.html
                                • function.mb-strrichr.html
                                • function.mb-strripos.html
                                • function.mb-strrpos.html
                                • function.mb-strstr.html
                                • function.mb-strtolower.html
                                • function.mb-strtoupper.html
                                • function.mb-strwidth.html
                                • function.mb-substitute-character.html
                                • function.mb-substr-count.html
                                • function.mb-substr.html
                                • function.mcrypt-cbc.html
                                • function.mcrypt-cfb.html
                                • function.mcrypt-create-iv.html
                                • function.mcrypt-decrypt.html
                                • function.mcrypt-ecb.html
                                • function.mcrypt-enc-get-algorithms-name.html
                                • function.mcrypt-enc-get-block-size.html
                                • function.mcrypt-enc-get-iv-size.html
                                • function.mcrypt-enc-get-key-size.html
                                • function.mcrypt-enc-get-modes-name.html
                                • function.mcrypt-enc-get-supported-key-sizes.html
                                • function.mcrypt-enc-is-block-algorithm-mode.html
                                • function.mcrypt-enc-is-block-algorithm.html
                                • function.mcrypt-enc-is-block-mode.html
                                • function.mcrypt-enc-self-test.html
                                • function.mcrypt-encrypt.html
                                • function.mcrypt-generic-deinit.html
                                • function.mcrypt-generic-end.html
                                • function.mcrypt-generic-init.html
                                • function.mcrypt-generic.html
                                • function.mcrypt-get-block-size.html
                                • function.mcrypt-get-cipher-name.html
                                • function.mcrypt-get-iv-size.html
                                • function.mcrypt-get-key-size.html
                                • function.mcrypt-list-algorithms.html
                                • function.mcrypt-list-modes.html
                                • function.mcrypt-module-close.html
                                • function.mcrypt-module-get-algo-block-size.html
                                • function.mcrypt-module-get-algo-key-size.html
                                • function.mcrypt-module-get-supported-key-sizes.html
                                • function.mcrypt-module-is-block-algorithm-mode.html
                                • function.mcrypt-module-is-block-algorithm.html
                                • function.mcrypt-module-is-block-mode.html
                                • function.mcrypt-module-open.html
                                • function.mcrypt-module-self-test.html
                                • function.mcrypt-ofb.html
                                • function.md5-file.html
                                • function.md5.html
                                • function.mdecrypt-generic.html
                                • function.memcache-debug.html
                                • function.memory-get-peak-usage.html
                                • function.memory-get-usage.html
                                • function.metaphone.html
                                • function.method-exists.html
                                • function.mhash-count.html
                                • function.mhash-get-block-size.html
                                • function.mhash-get-hash-name.html
                                • function.mhash-keygen-s2k.html
                                • function.mhash.html
                                • function.microtime.html
                                • function.mime-content-type.html
                                • function.min.html
                                • function.ming-keypress.html
                                • function.ming-setcubicthreshold.html
                                • function.ming-setscale.html
                                • function.ming-setswfcompression.html
                                • function.ming-useconstants.html
                                • function.ming-useswfversion.html
                                • function.mkdir.html
                                • function.mktime.html
                                • function.money-format.html
                                • function.mongodb.bson-fromjson.html
                                • function.mongodb.bson-fromphp.html
                                • function.mongodb.bson-tojson.html
                                • function.mongodb.bson-tophp.html
                                • function.move-uploaded-file.html
                                • function.mqseries-back.html
                                • function.mqseries-begin.html
                                • function.mqseries-close.html
                                • function.mqseries-cmit.html
                                • function.mqseries-conn.html
                                • function.mqseries-connx.html
                                • function.mqseries-disc.html
                                • function.mqseries-get.html
                                • function.mqseries-inq.html
                                • function.mqseries-open.html
                                • function.mqseries-put.html
                                • function.mqseries-put1.html
                                • function.mqseries-set.html
                                • function.mqseries-strerror.html
                                • function.msession-connect.html
                                • function.msession-count.html
                                • function.msession-create.html
                                • function.msession-destroy.html
                                • function.msession-disconnect.html
                                • function.msession-find.html
                                • function.msession-get-array.html
                                • function.msession-get-data.html
                                • function.msession-get.html
                                • function.msession-inc.html
                                • function.msession-list.html
                                • function.msession-listvar.html
                                • function.msession-lock.html
                                • function.msession-plugin.html
                                • function.msession-randstr.html
                                • function.msession-set-array.html
                                • function.msession-set-data.html
                                • function.msession-set.html
                                • function.msession-timeout.html
                                • function.msession-uniq.html
                                • function.msession-unlock.html
                                • function.msg-get-queue.html
                                • function.msg-queue-exists.html
                                • function.msg-receive.html
                                • function.msg-remove-queue.html
                                • function.msg-send.html
                                • function.msg-set-queue.html
                                • function.msg-stat-queue.html
                                • function.msql-affected-rows.html
                                • function.msql-close.html
                                • function.msql-connect.html
                                • function.msql-create-db.html
                                • function.msql-createdb.html
                                • function.msql-data-seek.html
                                • function.msql-db-query.html
                                • function.msql-dbname.html
                                • function.msql-drop-db.html
                                • function.msql-error.html
                                • function.msql-fetch-array.html
                                • function.msql-fetch-field.html
                                • function.msql-fetch-object.html
                                • function.msql-fetch-row.html
                                • function.msql-field-flags.html
                                • function.msql-field-len.html
                                • function.msql-field-name.html
                                • function.msql-field-seek.html
                                • function.msql-field-table.html
                                • function.msql-field-type.html
                                • function.msql-fieldflags.html
                                • function.msql-fieldlen.html
                                • function.msql-fieldname.html
                                • function.msql-fieldtable.html
                                • function.msql-fieldtype.html
                                • function.msql-free-result.html
                                • function.msql-list-dbs.html
                                • function.msql-list-fields.html
                                • function.msql-list-tables.html
                                • function.msql-num-fields.html
                                • function.msql-num-rows.html
                                • function.msql-numfields.html
                                • function.msql-numrows.html
                                • function.msql-pconnect.html
                                • function.msql-query.html
                                • function.msql-regcase.html
                                • function.msql-result.html
                                • function.msql-select-db.html
                                • function.msql-tablename.html
                                • function.msql.html
                                • function.mssql-bind.html
                                • function.mssql-close.html
                                • function.mssql-connect.html
                                • function.mssql-data-seek.html
                                • function.mssql-execute.html
                                • function.mssql-fetch-array.html
                                • function.mssql-fetch-assoc.html
                                • function.mssql-fetch-batch.html
                                • function.mssql-fetch-field.html
                                • function.mssql-fetch-object.html
                                • function.mssql-fetch-row.html
                                • function.mssql-field-length.html
                                • function.mssql-field-name.html
                                • function.mssql-field-seek.html
                                • function.mssql-field-type.html
                                • function.mssql-free-result.html
                                • function.mssql-free-statement.html
                                • function.mssql-get-last-message.html
                                • function.mssql-guid-string.html
                                • function.mssql-init.html
                                • function.mssql-min-error-severity.html
                                • function.mssql-min-message-severity.html
                                • function.mssql-next-result.html
                                • function.mssql-num-fields.html
                                • function.mssql-num-rows.html
                                • function.mssql-pconnect.html
                                • function.mssql-query.html
                                • function.mssql-result.html
                                • function.mssql-rows-affected.html
                                • function.mssql-select-db.html
                                • function.mt-getrandmax.html
                                • function.mt-rand.html
                                • function.mt-srand.html
                                • function.mysql-affected-rows.html
                                • function.mysql-client-encoding.html
                                • function.mysql-close.html
                                • function.mysql-connect.html
                                • function.mysql-create-db.html
                                • function.mysql-data-seek.html
                                • function.mysql-db-name.html
                                • function.mysql-db-query.html
                                • function.mysql-drop-db.html
                                • function.mysql-errno.html
                                • function.mysql-error.html
                                • function.mysql-escape-string.html
                                • function.mysql-fetch-array.html
                                • function.mysql-fetch-assoc.html
                                • function.mysql-fetch-field.html
                                • function.mysql-fetch-lengths.html
                                • function.mysql-fetch-object.html
                                • function.mysql-fetch-row.html
                                • function.mysql-field-flags.html
                                • function.mysql-field-len.html
                                • function.mysql-field-name.html
                                • function.mysql-field-seek.html
                                • function.mysql-field-table.html
                                • function.mysql-field-type.html
                                • function.mysql-free-result.html
                                • function.mysql-get-client-info.html
                                • function.mysql-get-host-info.html
                                • function.mysql-get-proto-info.html
                                • function.mysql-get-server-info.html
                                • function.mysql-info.html
                                • function.mysql-insert-id.html
                                • function.mysql-list-dbs.html
                                • function.mysql-list-fields.html
                                • function.mysql-list-processes.html
                                • function.mysql-list-tables.html
                                • function.mysql-num-fields.html
                                • function.mysql-num-rows.html
                                • function.mysql-pconnect.html
                                • function.mysql-ping.html
                                • function.mysql-query.html
                                • function.mysql-real-escape-string.html
                                • function.mysql-result.html
                                • function.mysql-select-db.html
                                • function.mysql-set-charset.html
                                • function.mysql-stat.html
                                • function.mysql-tablename.html
                                • function.mysql-thread-id.html
                                • function.mysql-unbuffered-query.html
                                • function.mysqli-bind-param.html
                                • function.mysqli-bind-result.html
                                • function.mysqli-client-encoding.html
                                • function.mysqli-connect.html
                                • function.mysqli-disable-reads-from-master.html
                                • function.mysqli-disable-rpl-parse.html
                                • function.mysqli-enable-reads-from-master.html
                                • function.mysqli-enable-rpl-parse.html
                                • function.mysqli-escape-string.html
                                • function.mysqli-execute.html
                                • function.mysqli-fetch.html
                                • function.mysqli-get-cache-stats.html
                                • function.mysqli-get-links-stats.html
                                • function.mysqli-get-metadata.html
                                • function.mysqli-master-query.html
                                • function.mysqli-param-count.html
                                • function.mysqli-report.html
                                • function.mysqli-rpl-parse-enabled.html
                                • function.mysqli-rpl-probe.html
                                • function.mysqli-send-long-data.html
                                • function.mysqli-set-opt.html
                                • function.mysqli-slave-query.html
                                • function.mysqlnd-memcache-get-config.html
                                • function.mysqlnd-memcache-set.html
                                • function.mysqlnd-ms-dump-servers.html
                                • function.mysqlnd-ms-fabric-select-global.html
                                • function.mysqlnd-ms-fabric-select-shard.html
                                • function.mysqlnd-ms-get-last-gtid.html
                                • function.mysqlnd-ms-get-last-used-connection.html
                                • function.mysqlnd-ms-get-stats.html
                                • function.mysqlnd-ms-match-wild.html
                                • function.mysqlnd-ms-query-is-select.html
                                • function.mysqlnd-ms-set-qos.html
                                • function.mysqlnd-ms-set-user-pick-server.html
                                • function.mysqlnd-ms-xa-begin.html
                                • function.mysqlnd-ms-xa-commit.html
                                • function.mysqlnd-ms-xa-gc.html
                                • function.mysqlnd-ms-xa-rollback.html
                                • function.mysqlnd-qc-clear-cache.html
                                • function.mysqlnd-qc-get-available-handlers.html
                                • function.mysqlnd-qc-get-cache-info.html
                                • function.mysqlnd-qc-get-core-stats.html
                                • function.mysqlnd-qc-get-normalized-query-trace-log.html
                                • function.mysqlnd-qc-get-query-trace-log.html
                                • function.mysqlnd-qc-set-cache-condition.html
                                • function.mysqlnd-qc-set-is-select.html
                                • function.mysqlnd-qc-set-storage-handler.html
                                • function.mysqlnd-qc-set-user-handlers.html
                                • function.mysqlnd-uh-convert-to-mysqlnd.html
                                • function.mysqlnd-uh-set-connection-proxy.html
                                • function.mysqlnd-uh-set-statement-proxy.html
                                • function.natcasesort.html
                                • function.natsort.html
                                • function.ncurses-addch.html
                                • function.ncurses-addchnstr.html
                                • function.ncurses-addchstr.html
                                • function.ncurses-addnstr.html
                                • function.ncurses-addstr.html
                                • function.ncurses-assume-default-colors.html
                                • function.ncurses-attroff.html
                                • function.ncurses-attron.html
                                • function.ncurses-attrset.html
                                • function.ncurses-baudrate.html
                                • function.ncurses-beep.html
                                • function.ncurses-bkgd.html
                                • function.ncurses-bkgdset.html
                                • function.ncurses-border.html
                                • function.ncurses-bottom-panel.html
                                • function.ncurses-can-change-color.html
                                • function.ncurses-cbreak.html
                                • function.ncurses-clear.html
                                • function.ncurses-clrtobot.html
                                • function.ncurses-clrtoeol.html
                                • function.ncurses-color-content.html
                                • function.ncurses-color-set.html
                                • function.ncurses-curs-set.html
                                • function.ncurses-def-prog-mode.html
                                • function.ncurses-def-shell-mode.html
                                • function.ncurses-define-key.html
                                • function.ncurses-del-panel.html
                                • function.ncurses-delay-output.html
                                • function.ncurses-delch.html
                                • function.ncurses-deleteln.html
                                • function.ncurses-delwin.html
                                • function.ncurses-doupdate.html
                                • function.ncurses-echo.html
                                • function.ncurses-echochar.html
                                • function.ncurses-end.html
                                • function.ncurses-erase.html
                                • function.ncurses-erasechar.html
                                • function.ncurses-filter.html
                                • function.ncurses-flash.html
                                • function.ncurses-flushinp.html
                                • function.ncurses-getch.html
                                • function.ncurses-getmaxyx.html
                                • function.ncurses-getmouse.html
                                • function.ncurses-getyx.html
                                • function.ncurses-halfdelay.html
                                • function.ncurses-has-colors.html
                                • function.ncurses-has-ic.html
                                • function.ncurses-has-il.html
                                • function.ncurses-has-key.html
                                • function.ncurses-hide-panel.html
                                • function.ncurses-hline.html
                                • function.ncurses-inch.html
                                • function.ncurses-init-color.html
                                • function.ncurses-init-pair.html
                                • function.ncurses-init.html
                                • function.ncurses-insch.html
                                • function.ncurses-insdelln.html
                                • function.ncurses-insertln.html
                                • function.ncurses-insstr.html
                                • function.ncurses-instr.html
                                • function.ncurses-isendwin.html
                                • function.ncurses-keyok.html
                                • function.ncurses-keypad.html
                                • function.ncurses-killchar.html
                                • function.ncurses-longname.html
                                • function.ncurses-meta.html
                                • function.ncurses-mouse-trafo.html
                                • function.ncurses-mouseinterval.html
                                • function.ncurses-mousemask.html
                                • function.ncurses-move-panel.html
                                • function.ncurses-move.html
                                • function.ncurses-mvaddch.html
                                • function.ncurses-mvaddchnstr.html
                                • function.ncurses-mvaddchstr.html
                                • function.ncurses-mvaddnstr.html
                                • function.ncurses-mvaddstr.html
                                • function.ncurses-mvcur.html
                                • function.ncurses-mvdelch.html
                                • function.ncurses-mvgetch.html
                                • function.ncurses-mvhline.html
                                • function.ncurses-mvinch.html
                                • function.ncurses-mvvline.html
                                • function.ncurses-mvwaddstr.html
                                • function.ncurses-napms.html
                                • function.ncurses-new-panel.html
                                • function.ncurses-newpad.html
                                • function.ncurses-newwin.html
                                • function.ncurses-nl.html
                                • function.ncurses-nocbreak.html
                                • function.ncurses-noecho.html
                                • function.ncurses-nonl.html
                                • function.ncurses-noqiflush.html
                                • function.ncurses-noraw.html
                                • function.ncurses-pair-content.html
                                • function.ncurses-panel-above.html
                                • function.ncurses-panel-below.html
                                • function.ncurses-panel-window.html
                                • function.ncurses-pnoutrefresh.html
                                • function.ncurses-prefresh.html
                                • function.ncurses-putp.html
                                • function.ncurses-qiflush.html
                                • function.ncurses-raw.html
                                • function.ncurses-refresh.html
                                • function.ncurses-replace-panel.html
                                • function.ncurses-reset-prog-mode.html
                                • function.ncurses-reset-shell-mode.html
                                • function.ncurses-resetty.html
                                • function.ncurses-savetty.html
                                • function.ncurses-scr-dump.html
                                • function.ncurses-scr-init.html
                                • function.ncurses-scr-restore.html
                                • function.ncurses-scr-set.html
                                • function.ncurses-scrl.html
                                • function.ncurses-show-panel.html
                                • function.ncurses-slk-attr.html
                                • function.ncurses-slk-attroff.html
                                • function.ncurses-slk-attron.html
                                • function.ncurses-slk-attrset.html
                                • function.ncurses-slk-clear.html
                                • function.ncurses-slk-color.html
                                • function.ncurses-slk-init.html
                                • function.ncurses-slk-noutrefresh.html
                                • function.ncurses-slk-refresh.html
                                • function.ncurses-slk-restore.html
                                • function.ncurses-slk-set.html
                                • function.ncurses-slk-touch.html
                                • function.ncurses-standend.html
                                • function.ncurses-standout.html
                                • function.ncurses-start-color.html
                                • function.ncurses-termattrs.html
                                • function.ncurses-termname.html
                                • function.ncurses-timeout.html
                                • function.ncurses-top-panel.html
                                • function.ncurses-typeahead.html
                                • function.ncurses-ungetch.html
                                • function.ncurses-ungetmouse.html
                                • function.ncurses-update-panels.html
                                • function.ncurses-use-default-colors.html
                                • function.ncurses-use-env.html
                                • function.ncurses-use-extended-names.html
                                • function.ncurses-vidattr.html
                                • function.ncurses-vline.html
                                • function.ncurses-waddch.html
                                • function.ncurses-waddstr.html
                                • function.ncurses-wattroff.html
                                • function.ncurses-wattron.html
                                • function.ncurses-wattrset.html
                                • function.ncurses-wborder.html
                                • function.ncurses-wclear.html
                                • function.ncurses-wcolor-set.html
                                • function.ncurses-werase.html
                                • function.ncurses-wgetch.html
                                • function.ncurses-whline.html
                                • function.ncurses-wmouse-trafo.html
                                • function.ncurses-wmove.html
                                • function.ncurses-wnoutrefresh.html
                                • function.ncurses-wrefresh.html
                                • function.ncurses-wstandend.html
                                • function.ncurses-wstandout.html
                                • function.ncurses-wvline.html
                                • function.newt-bell.html
                                • function.newt-button-bar.html
                                • function.newt-button.html
                                • function.newt-centered-window.html
                                • function.newt-checkbox-get-value.html
                                • function.newt-checkbox-set-flags.html
                                • function.newt-checkbox-set-value.html
                                • function.newt-checkbox-tree-add-item.html
                                • function.newt-checkbox-tree-find-item.html
                                • function.newt-checkbox-tree-get-current.html
                                • function.newt-checkbox-tree-get-entry-value.html
                                • function.newt-checkbox-tree-get-multi-selection.html
                                • function.newt-checkbox-tree-get-selection.html
                                • function.newt-checkbox-tree-multi.html
                                • function.newt-checkbox-tree-set-current.html
                                • function.newt-checkbox-tree-set-entry-value.html
                                • function.newt-checkbox-tree-set-entry.html
                                • function.newt-checkbox-tree-set-width.html
                                • function.newt-checkbox-tree.html
                                • function.newt-checkbox.html
                                • function.newt-clear-key-buffer.html
                                • function.newt-cls.html
                                • function.newt-compact-button.html
                                • function.newt-component-add-callback.html
                                • function.newt-component-takes-focus.html
                                • function.newt-create-grid.html
                                • function.newt-cursor-off.html
                                • function.newt-cursor-on.html
                                • function.newt-delay.html
                                • function.newt-draw-form.html
                                • function.newt-draw-root-text.html
                                • function.newt-entry-get-value.html
                                • function.newt-entry-set-filter.html
                                • function.newt-entry-set-flags.html
                                • function.newt-entry-set.html
                                • function.newt-entry.html
                                • function.newt-finished.html
                                • function.newt-form-add-component.html
                                • function.newt-form-add-components.html
                                • function.newt-form-add-hot-key.html
                                • function.newt-form-destroy.html
                                • function.newt-form-get-current.html
                                • function.newt-form-run.html
                                • function.newt-form-set-background.html
                                • function.newt-form-set-height.html
                                • function.newt-form-set-size.html
                                • function.newt-form-set-timer.html
                                • function.newt-form-set-width.html
                                • function.newt-form-watch-fd.html
                                • function.newt-form.html
                                • function.newt-get-screen-size.html
                                • function.newt-grid-add-components-to-form.html
                                • function.newt-grid-basic-window.html
                                • function.newt-grid-free.html
                                • function.newt-grid-get-size.html
                                • function.newt-grid-h-close-stacked.html
                                • function.newt-grid-h-stacked.html
                                • function.newt-grid-place.html
                                • function.newt-grid-set-field.html
                                • function.newt-grid-simple-window.html
                                • function.newt-grid-v-close-stacked.html
                                • function.newt-grid-v-stacked.html
                                • function.newt-grid-wrapped-window-at.html
                                • function.newt-grid-wrapped-window.html
                                • function.newt-init.html
                                • function.newt-label-set-text.html
                                • function.newt-label.html
                                • function.newt-listbox-append-entry.html
                                • function.newt-listbox-clear-selection.html
                                • function.newt-listbox-clear.html
                                • function.newt-listbox-delete-entry.html
                                • function.newt-listbox-get-current.html
                                • function.newt-listbox-get-selection.html
                                • function.newt-listbox-insert-entry.html
                                • function.newt-listbox-item-count.html
                                • function.newt-listbox-select-item.html
                                • function.newt-listbox-set-current-by-key.html
                                • function.newt-listbox-set-current.html
                                • function.newt-listbox-set-data.html
                                • function.newt-listbox-set-entry.html
                                • function.newt-listbox-set-width.html
                                • function.newt-listbox.html
                                • function.newt-listitem-get-data.html
                                • function.newt-listitem-set.html
                                • function.newt-listitem.html
                                • function.newt-open-window.html
                                • function.newt-pop-help-line.html
                                • function.newt-pop-window.html
                                • function.newt-push-help-line.html
                                • function.newt-radio-get-current.html
                                • function.newt-radiobutton.html
                                • function.newt-redraw-help-line.html
                                • function.newt-reflow-text.html
                                • function.newt-refresh.html
                                • function.newt-resize-screen.html
                                • function.newt-resume.html
                                • function.newt-run-form.html
                                • function.newt-scale-set.html
                                • function.newt-scale.html
                                • function.newt-scrollbar-set.html
                                • function.newt-set-help-callback.html
                                • function.newt-set-suspend-callback.html
                                • function.newt-suspend.html
                                • function.newt-textbox-get-num-lines.html
                                • function.newt-textbox-reflowed.html
                                • function.newt-textbox-set-height.html
                                • function.newt-textbox-set-text.html
                                • function.newt-textbox.html
                                • function.newt-vertical-scrollbar.html
                                • function.newt-wait-for-key.html
                                • function.newt-win-choice.html
                                • function.newt-win-entries.html
                                • function.newt-win-menu.html
                                • function.newt-win-message.html
                                • function.newt-win-messagev.html
                                • function.newt-win-ternary.html
                                • function.next.html
                                • function.ngettext.html
                                • function.nl-langinfo.html
                                • function.nl2br.html
                                • function.nsapi-request-headers.html
                                • function.nsapi-response-headers.html
                                • function.nsapi-virtual.html
                                • function.nthmac.html
                                • function.number-format.html
                                • function.oauth-get-sbs.html
                                • function.oauth-urlencode.html
                                • function.ob-clean.html
                                • function.ob-deflatehandler.html
                                • function.ob-end-clean.html
                                • function.ob-end-flush.html
                                • function.ob-etaghandler.html
                                • function.ob-flush.html
                                • function.ob-get-clean.html
                                • function.ob-get-contents.html
                                • function.ob-get-flush.html
                                • function.ob-get-length.html
                                • function.ob-get-level.html
                                • function.ob-get-status.html
                                • function.ob-gzhandler.html
                                • function.ob-iconv-handler.html
                                • function.ob-implicit-flush.html
                                • function.ob-inflatehandler.html
                                • function.ob-list-handlers.html
                                • function.ob-start.html
                                • function.ob-tidyhandler.html
                                • function.oci-bind-array-by-name.html
                                • function.oci-bind-by-name.html
                                • function.oci-cancel.html
                                • function.oci-client-version.html
                                • function.oci-close.html
                                • function.oci-commit.html
                                • function.oci-connect.html
                                • function.oci-define-by-name.html
                                • function.oci-error.html
                                • function.oci-execute.html
                                • function.oci-fetch-all.html
                                • function.oci-fetch-array.html
                                • function.oci-fetch-assoc.html
                                • function.oci-fetch-object.html
                                • function.oci-fetch-row.html
                                • function.oci-fetch.html
                                • function.oci-field-is-null.html
                                • function.oci-field-name.html
                                • function.oci-field-precision.html
                                • function.oci-field-scale.html
                                • function.oci-field-size.html
                                • function.oci-field-type-raw.html
                                • function.oci-field-type.html
                                • function.oci-free-descriptor.html
                                • function.oci-free-statement.html
                                • function.oci-get-implicit-resultset.html
                                • function.oci-internal-debug.html
                                • function.oci-lob-copy.html
                                • function.oci-lob-is-equal.html
                                • function.oci-new-collection.html
                                • function.oci-new-connect.html
                                • function.oci-new-cursor.html
                                • function.oci-new-descriptor.html
                                • function.oci-num-fields.html
                                • function.oci-num-rows.html
                                • function.oci-parse.html
                                • function.oci-password-change.html
                                • function.oci-pconnect.html
                                • function.oci-result.html
                                • function.oci-rollback.html
                                • function.oci-server-version.html
                                • function.oci-set-action.html
                                • function.oci-set-client-identifier.html
                                • function.oci-set-client-info.html
                                • function.oci-set-edition.html
                                • function.oci-set-module-name.html
                                • function.oci-set-prefetch.html
                                • function.oci-statement-type.html
                                • function.ocibindbyname.html
                                • function.ocicancel.html
                                • function.ocicloselob.html
                                • function.ocicollappend.html
                                • function.ocicollassign.html
                                • function.ocicollassignelem.html
                                • function.ocicollgetelem.html
                                • function.ocicollmax.html
                                • function.ocicollsize.html
                                • function.ocicolltrim.html
                                • function.ocicolumnisnull.html
                                • function.ocicolumnname.html
                                • function.ocicolumnprecision.html
                                • function.ocicolumnscale.html
                                • function.ocicolumnsize.html
                                • function.ocicolumntype.html
                                • function.ocicolumntyperaw.html
                                • function.ocicommit.html
                                • function.ocidefinebyname.html
                                • function.ocierror.html
                                • function.ociexecute.html
                                • function.ocifetch.html
                                • function.ocifetchinto.html
                                • function.ocifetchstatement.html
                                • function.ocifreecollection.html
                                • function.ocifreecursor.html
                                • function.ocifreedesc.html
                                • function.ocifreestatement.html
                                • function.ociinternaldebug.html
                                • function.ociloadlob.html
                                • function.ocilogoff.html
                                • function.ocilogon.html
                                • function.ocinewcollection.html
                                • function.ocinewcursor.html
                                • function.ocinewdescriptor.html
                                • function.ocinlogon.html
                                • function.ocinumcols.html
                                • function.ociparse.html
                                • function.ociplogon.html
                                • function.ociresult.html
                                • function.ocirollback.html
                                • function.ocirowcount.html
                                • function.ocisavelob.html
                                • function.ocisavelobfile.html
                                • function.ociserverversion.html
                                • function.ocisetprefetch.html
                                • function.ocistatementtype.html
                                • function.ociwritelobtofile.html
                                • function.ociwritetemporarylob.html
                                • function.octdec.html
                                • function.odbc-autocommit.html
                                • function.odbc-binmode.html
                                • function.odbc-close-all.html
                                • function.odbc-close.html
                                • function.odbc-columnprivileges.html
                                • function.odbc-columns.html
                                • function.odbc-commit.html
                                • function.odbc-connect.html
                                • function.odbc-cursor.html
                                • function.odbc-data-source.html
                                • function.odbc-do.html
                                • function.odbc-error.html
                                • function.odbc-errormsg.html
                                • function.odbc-exec.html
                                • function.odbc-execute.html
                                • function.odbc-fetch-array.html
                                • function.odbc-fetch-into.html
                                • function.odbc-fetch-object.html
                                • function.odbc-fetch-row.html
                                • function.odbc-field-len.html
                                • function.odbc-field-name.html
                                • function.odbc-field-num.html
                                • function.odbc-field-precision.html
                                • function.odbc-field-scale.html
                                • function.odbc-field-type.html
                                • function.odbc-foreignkeys.html
                                • function.odbc-free-result.html
                                • function.odbc-gettypeinfo.html
                                • function.odbc-longreadlen.html
                                • function.odbc-next-result.html
                                • function.odbc-num-fields.html
                                • function.odbc-num-rows.html
                                • function.odbc-pconnect.html
                                • function.odbc-prepare.html
                                • function.odbc-primarykeys.html
                                • function.odbc-procedurecolumns.html
                                • function.odbc-procedures.html
                                • function.odbc-result-all.html
                                • function.odbc-result.html
                                • function.odbc-rollback.html
                                • function.odbc-setoption.html
                                • function.odbc-specialcolumns.html
                                • function.odbc-statistics.html
                                • function.odbc-tableprivileges.html
                                • function.odbc-tables.html
                                • function.opcache-compile-file.html
                                • function.opcache-get-configuration.html
                                • function.opcache-get-status.html
                                • function.opcache-invalidate.html
                                • function.opcache-is-script-cached.html
                                • function.opcache-reset.html
                                • function.openal-buffer-create.html
                                • function.openal-buffer-data.html
                                • function.openal-buffer-destroy.html
                                • function.openal-buffer-get.html
                                • function.openal-buffer-loadwav.html
                                • function.openal-context-create.html
                                • function.openal-context-current.html
                                • function.openal-context-destroy.html
                                • function.openal-context-process.html
                                • function.openal-context-suspend.html
                                • function.openal-device-close.html
                                • function.openal-device-open.html
                                • function.openal-listener-get.html
                                • function.openal-listener-set.html
                                • function.openal-source-create.html
                                • function.openal-source-destroy.html
                                • function.openal-source-get.html
                                • function.openal-source-pause.html
                                • function.openal-source-play.html
                                • function.openal-source-rewind.html
                                • function.openal-source-set.html
                                • function.openal-source-stop.html
                                • function.openal-stream.html
                                • function.opendir.html
                                • function.openlog.html
                                • function.openssl-cipher-iv-length.html
                                • function.openssl-csr-export-to-file.html
                                • function.openssl-csr-export.html
                                • function.openssl-csr-get-public-key.html
                                • function.openssl-csr-get-subject.html
                                • function.openssl-csr-new.html
                                • function.openssl-csr-sign.html
                                • function.openssl-decrypt.html
                                • function.openssl-dh-compute-key.html
                                • function.openssl-digest.html
                                • function.openssl-encrypt.html
                                • function.openssl-error-string.html
                                • function.openssl-free-key.html
                                • function.openssl-get-cert-locations.html
                                • function.openssl-get-cipher-methods.html
                                • function.openssl-get-md-methods.html
                                • function.openssl-get-privatekey.html
                                • function.openssl-get-publickey.html
                                • function.openssl-open.html
                                • function.openssl-pbkdf2.html
                                • function.openssl-pkcs12-export-to-file.html
                                • function.openssl-pkcs12-export.html
                                • function.openssl-pkcs12-read.html
                                • function.openssl-pkcs7-decrypt.html
                                • function.openssl-pkcs7-encrypt.html
                                • function.openssl-pkcs7-sign.html
                                • function.openssl-pkcs7-verify.html
                                • function.openssl-pkey-export-to-file.html
                                • function.openssl-pkey-export.html
                                • function.openssl-pkey-free.html
                                • function.openssl-pkey-get-details.html
                                • function.openssl-pkey-get-private.html
                                • function.openssl-pkey-get-public.html
                                • function.openssl-pkey-new.html
                                • function.openssl-private-decrypt.html
                                • function.openssl-private-encrypt.html
                                • function.openssl-public-decrypt.html
                                • function.openssl-public-encrypt.html
                                • function.openssl-random-pseudo-bytes.html
                                • function.openssl-seal.html
                                • function.openssl-sign.html
                                • function.openssl-spki-export-challenge.html
                                • function.openssl-spki-export.html
                                • function.openssl-spki-new.html
                                • function.openssl-spki-verify.html
                                • function.openssl-verify.html
                                • function.openssl-x509-check-private-key.html
                                • function.openssl-x509-checkpurpose.html
                                • function.openssl-x509-export-to-file.html
                                • function.openssl-x509-export.html
                                • function.openssl-x509-fingerprint.html
                                • function.openssl-x509-free.html
                                • function.openssl-x509-parse.html
                                • function.openssl-x509-read.html
                                • function.ord.html
                                • function.output-add-rewrite-var.html
                                • function.output-reset-rewrite-vars.html
                                • function.override-function.html
                                • function.pack.html
                                • function.parse-ini-file.html
                                • function.parse-ini-string.html
                                • function.parse-str.html
                                • function.parse-url.html
                                • function.parsekit-compile-file.html
                                • function.parsekit-compile-string.html
                                • function.parsekit-func-arginfo.html
                                • function.passthru.html
                                • function.password-get-info.html
                                • function.password-hash.html
                                • function.password-needs-rehash.html
                                • function.password-verify.html
                                • function.pathinfo.html
                                • function.pclose.html
                                • function.pcntl-alarm.html
                                • function.pcntl-errno.html
                                • function.pcntl-exec.html
                                • function.pcntl-fork.html
                                • function.pcntl-get-last-error.html
                                • function.pcntl-getpriority.html
                                • function.pcntl-setpriority.html
                                • function.pcntl-signal-dispatch.html
                                • function.pcntl-signal.html
                                • function.pcntl-sigprocmask.html
                                • function.pcntl-sigtimedwait.html
                                • function.pcntl-sigwaitinfo.html
                                • function.pcntl-strerror.html
                                • function.pcntl-wait.html
                                • function.pcntl-waitpid.html
                                • function.pcntl-wexitstatus.html
                                • function.pcntl-wifexited.html
                                • function.pcntl-wifsignaled.html
                                • function.pcntl-wifstopped.html
                                • function.pcntl-wstopsig.html
                                • function.pcntl-wtermsig.html
                                • function.pdf-activate-item.html
                                • function.pdf-add-annotation.html
                                • function.pdf-add-bookmark.html
                                • function.pdf-add-launchlink.html
                                • function.pdf-add-locallink.html
                                • function.pdf-add-nameddest.html
                                • function.pdf-add-note.html
                                • function.pdf-add-outline.html
                                • function.pdf-add-pdflink.html
                                • function.pdf-add-table-cell.html
                                • function.pdf-add-textflow.html
                                • function.pdf-add-thumbnail.html
                                • function.pdf-add-weblink.html
                                • function.pdf-arc.html
                                • function.pdf-arcn.html
                                • function.pdf-attach-file.html
                                • function.pdf-begin-document.html
                                • function.pdf-begin-font.html
                                • function.pdf-begin-glyph.html
                                • function.pdf-begin-item.html
                                • function.pdf-begin-layer.html
                                • function.pdf-begin-page-ext.html
                                • function.pdf-begin-page.html
                                • function.pdf-begin-pattern.html
                                • function.pdf-begin-template-ext.html
                                • function.pdf-begin-template.html
                                • function.pdf-circle.html
                                • function.pdf-clip.html
                                • function.pdf-close-image.html
                                • function.pdf-close-pdi-page.html
                                • function.pdf-close-pdi.html
                                • function.pdf-close.html
                                • function.pdf-closepath-fill-stroke.html
                                • function.pdf-closepath-stroke.html
                                • function.pdf-closepath.html
                                • function.pdf-concat.html
                                • function.pdf-continue-text.html
                                • function.pdf-create-3dview.html
                                • function.pdf-create-action.html
                                • function.pdf-create-annotation.html
                                • function.pdf-create-bookmark.html
                                • function.pdf-create-field.html
                                • function.pdf-create-fieldgroup.html
                                • function.pdf-create-gstate.html
                                • function.pdf-create-pvf.html
                                • function.pdf-create-textflow.html
                                • function.pdf-curveto.html
                                • function.pdf-define-layer.html
                                • function.pdf-delete-pvf.html
                                • function.pdf-delete-table.html
                                • function.pdf-delete-textflow.html
                                • function.pdf-delete.html
                                • function.pdf-encoding-set-char.html
                                • function.pdf-end-document.html
                                • function.pdf-end-font.html
                                • function.pdf-end-glyph.html
                                • function.pdf-end-item.html
                                • function.pdf-end-layer.html
                                • function.pdf-end-page-ext.html
                                • function.pdf-end-page.html
                                • function.pdf-end-pattern.html
                                • function.pdf-end-template.html
                                • function.pdf-endpath.html
                                • function.pdf-fill-imageblock.html
                                • function.pdf-fill-pdfblock.html
                                • function.pdf-fill-stroke.html
                                • function.pdf-fill-textblock.html
                                • function.pdf-fill.html
                                • function.pdf-findfont.html
                                • function.pdf-fit-image.html
                                • function.pdf-fit-pdi-page.html
                                • function.pdf-fit-table.html
                                • function.pdf-fit-textflow.html
                                • function.pdf-fit-textline.html
                                • function.pdf-get-apiname.html
                                • function.pdf-get-buffer.html
                                • function.pdf-get-errmsg.html
                                • function.pdf-get-errnum.html
                                • function.pdf-get-font.html
                                • function.pdf-get-fontname.html
                                • function.pdf-get-fontsize.html
                                • function.pdf-get-image-height.html
                                • function.pdf-get-image-width.html
                                • function.pdf-get-majorversion.html
                                • function.pdf-get-minorversion.html
                                • function.pdf-get-parameter.html
                                • function.pdf-get-pdi-parameter.html
                                • function.pdf-get-pdi-value.html
                                • function.pdf-get-value.html
                                • function.pdf-info-font.html
                                • function.pdf-info-matchbox.html
                                • function.pdf-info-table.html
                                • function.pdf-info-textflow.html
                                • function.pdf-info-textline.html
                                • function.pdf-initgraphics.html
                                • function.pdf-lineto.html
                                • function.pdf-load-3ddata.html
                                • function.pdf-load-font.html
                                • function.pdf-load-iccprofile.html
                                • function.pdf-load-image.html
                                • function.pdf-makespotcolor.html
                                • function.pdf-moveto.html
                                • function.pdf-new.html
                                • function.pdf-open-ccitt.html
                                • function.pdf-open-file.html
                                • function.pdf-open-gif.html
                                • function.pdf-open-image-file.html
                                • function.pdf-open-image.html
                                • function.pdf-open-jpeg.html
                                • function.pdf-open-memory-image.html
                                • function.pdf-open-pdi-document.html
                                • function.pdf-open-pdi-page.html
                                • function.pdf-open-pdi.html
                                • function.pdf-open-tiff.html
                                • function.pdf-pcos-get-number.html
                                • function.pdf-pcos-get-stream.html
                                • function.pdf-pcos-get-string.html
                                • function.pdf-place-image.html
                                • function.pdf-place-pdi-page.html
                                • function.pdf-process-pdi.html
                                • function.pdf-rect.html
                                • function.pdf-restore.html
                                • function.pdf-resume-page.html
                                • function.pdf-rotate.html
                                • function.pdf-save.html
                                • function.pdf-scale.html
                                • function.pdf-set-border-color.html
                                • function.pdf-set-border-dash.html
                                • function.pdf-set-border-style.html
                                • function.pdf-set-char-spacing.html
                                • function.pdf-set-duration.html
                                • function.pdf-set-gstate.html
                                • function.pdf-set-horiz-scaling.html
                                • function.pdf-set-info-author.html
                                • function.pdf-set-info-creator.html
                                • function.pdf-set-info-keywords.html
                                • function.pdf-set-info-subject.html
                                • function.pdf-set-info-title.html
                                • function.pdf-set-info.html
                                • function.pdf-set-layer-dependency.html
                                • function.pdf-set-leading.html
                                • function.pdf-set-parameter.html
                                • function.pdf-set-text-matrix.html
                                • function.pdf-set-text-pos.html
                                • function.pdf-set-text-rendering.html
                                • function.pdf-set-text-rise.html
                                • function.pdf-set-value.html
                                • function.pdf-set-word-spacing.html
                                • function.pdf-setcolor.html
                                • function.pdf-setdash.html
                                • function.pdf-setdashpattern.html
                                • function.pdf-setflat.html
                                • function.pdf-setfont.html
                                • function.pdf-setgray-fill.html
                                • function.pdf-setgray-stroke.html
                                • function.pdf-setgray.html
                                • function.pdf-setlinecap.html
                                • function.pdf-setlinejoin.html
                                • function.pdf-setlinewidth.html
                                • function.pdf-setmatrix.html
                                • function.pdf-setmiterlimit.html
                                • function.pdf-setpolydash.html
                                • function.pdf-setrgbcolor-fill.html
                                • function.pdf-setrgbcolor-stroke.html
                                • function.pdf-setrgbcolor.html
                                • function.pdf-shading-pattern.html
                                • function.pdf-shading.html
                                • function.pdf-shfill.html
                                • function.pdf-show-boxed.html
                                • function.pdf-show-xy.html
                                • function.pdf-show.html
                                • function.pdf-skew.html
                                • function.pdf-stringwidth.html
                                • function.pdf-stroke.html
                                • function.pdf-suspend-page.html
                                • function.pdf-translate.html
                                • function.pdf-utf16-to-utf8.html
                                • function.pdf-utf32-to-utf16.html
                                • function.pdf-utf8-to-utf16.html
                                • function.pfsockopen.html
                                • function.pg-affected-rows.html
                                • function.pg-cancel-query.html
                                • function.pg-client-encoding.html
                                • function.pg-close.html
                                • function.pg-connect-poll.html
                                • function.pg-connect.html
                                • function.pg-connection-busy.html
                                • function.pg-connection-reset.html
                                • function.pg-connection-status.html
                                • function.pg-consume-input.html
                                • function.pg-convert.html
                                • function.pg-copy-from.html
                                • function.pg-copy-to.html
                                • function.pg-dbname.html
                                • function.pg-delete.html
                                • function.pg-end-copy.html
                                • function.pg-escape-bytea.html
                                • function.pg-escape-identifier.html
                                • function.pg-escape-literal.html
                                • function.pg-escape-string.html
                                • function.pg-execute.html
                                • function.pg-fetch-all-columns.html
                                • function.pg-fetch-all.html
                                • function.pg-fetch-array.html
                                • function.pg-fetch-assoc.html
                                • function.pg-fetch-object.html
                                • function.pg-fetch-result.html
                                • function.pg-fetch-row.html
                                • function.pg-field-is-null.html
                                • function.pg-field-name.html
                                • function.pg-field-num.html
                                • function.pg-field-prtlen.html
                                • function.pg-field-size.html
                                • function.pg-field-table.html
                                • function.pg-field-type-oid.html
                                • function.pg-field-type.html
                                • function.pg-flush.html
                                • function.pg-free-result.html
                                • function.pg-get-notify.html
                                • function.pg-get-pid.html
                                • function.pg-get-result.html
                                • function.pg-host.html
                                • function.pg-insert.html
                                • function.pg-last-error.html
                                • function.pg-last-notice.html
                                • function.pg-last-oid.html
                                • function.pg-lo-close.html
                                • function.pg-lo-create.html
                                • function.pg-lo-export.html
                                • function.pg-lo-import.html
                                • function.pg-lo-open.html
                                • function.pg-lo-read-all.html
                                • function.pg-lo-read.html
                                • function.pg-lo-seek.html
                                • function.pg-lo-tell.html
                                • function.pg-lo-truncate.html
                                • function.pg-lo-unlink.html
                                • function.pg-lo-write.html
                                • function.pg-meta-data.html
                                • function.pg-num-fields.html
                                • function.pg-num-rows.html
                                • function.pg-options.html
                                • function.pg-parameter-status.html
                                • function.pg-pconnect.html
                                • function.pg-ping.html
                                • function.pg-port.html
                                • function.pg-prepare.html
                                • function.pg-put-line.html
                                • function.pg-query-params.html
                                • function.pg-query.html
                                • function.pg-result-error-field.html
                                • function.pg-result-error.html
                                • function.pg-result-seek.html
                                • function.pg-result-status.html
                                • function.pg-select.html
                                • function.pg-send-execute.html
                                • function.pg-send-prepare.html
                                • function.pg-send-query-params.html
                                • function.pg-send-query.html
                                • function.pg-set-client-encoding.html
                                • function.pg-set-error-verbosity.html
                                • function.pg-socket.html
                                • function.pg-trace.html
                                • function.pg-transaction-status.html
                                • function.pg-tty.html
                                • function.pg-unescape-bytea.html
                                • function.pg-untrace.html
                                • function.pg-update.html
                                • function.pg-version.html
                                • function.php-check-syntax.html
                                • function.php-ini-loaded-file.html
                                • function.php-ini-scanned-files.html
                                • function.php-logo-guid.html
                                • function.php-sapi-name.html
                                • function.php-strip-whitespace.html
                                • function.php-uname.html
                                • function.phpcredits.html
                                • function.phpinfo.html
                                • function.phpversion.html
                                • function.pi.html
                                • function.png2wbmp.html
                                • function.popen.html
                                • function.pos.html
                                • function.posix-access.html
                                • function.posix-ctermid.html
                                • function.posix-errno.html
                                • function.posix-get-last-error.html
                                • function.posix-getcwd.html
                                • function.posix-getegid.html
                                • function.posix-geteuid.html
                                • function.posix-getgid.html
                                • function.posix-getgrgid.html
                                • function.posix-getgrnam.html
                                • function.posix-getgroups.html
                                • function.posix-getlogin.html
                                • function.posix-getpgid.html
                                • function.posix-getpgrp.html
                                • function.posix-getpid.html
                                • function.posix-getppid.html
                                • function.posix-getpwnam.html
                                • function.posix-getpwuid.html
                                • function.posix-getrlimit.html
                                • function.posix-getsid.html
                                • function.posix-getuid.html
                                • function.posix-initgroups.html
                                • function.posix-isatty.html
                                • function.posix-kill.html
                                • function.posix-mkfifo.html
                                • function.posix-mknod.html
                                • function.posix-setegid.html
                                • function.posix-seteuid.html
                                • function.posix-setgid.html
                                • function.posix-setpgid.html
                                • function.posix-setrlimit.html
                                • function.posix-setsid.html
                                • function.posix-setuid.html
                                • function.posix-strerror.html
                                • function.posix-times.html
                                • function.posix-ttyname.html
                                • function.posix-uname.html
                                • function.pow.html
                                • function.preg-filter.html
                                • function.preg-grep.html
                                • function.preg-last-error.html
                                • function.preg-match-all.html
                                • function.preg-match.html
                                • function.preg-quote.html
                                • function.preg-replace-callback-array.html
                                • function.preg-replace-callback.html
                                • function.preg-replace.html
                                • function.preg-split.html
                                • function.prev.html
                                • function.print-r.html
                                • function.print.html
                                • function.printf.html
                                • function.proc-close.html
                                • function.proc-get-status.html
                                • function.proc-nice.html
                                • function.proc-open.html
                                • function.proc-terminate.html
                                • function.property-exists.html
                                • function.ps-add-bookmark.html
                                • function.ps-add-launchlink.html
                                • function.ps-add-locallink.html
                                • function.ps-add-note.html
                                • function.ps-add-pdflink.html
                                • function.ps-add-weblink.html
                                • function.ps-arc.html
                                • function.ps-arcn.html
                                • function.ps-begin-page.html
                                • function.ps-begin-pattern.html
                                • function.ps-begin-template.html
                                • function.ps-circle.html
                                • function.ps-clip.html
                                • function.ps-close-image.html
                                • function.ps-close.html
                                • function.ps-closepath-stroke.html
                                • function.ps-closepath.html
                                • function.ps-continue-text.html
                                • function.ps-curveto.html
                                • function.ps-delete.html
                                • function.ps-end-page.html
                                • function.ps-end-pattern.html
                                • function.ps-end-template.html
                                • function.ps-fill-stroke.html
                                • function.ps-fill.html
                                • function.ps-findfont.html
                                • function.ps-get-buffer.html
                                • function.ps-get-parameter.html
                                • function.ps-get-value.html
                                • function.ps-hyphenate.html
                                • function.ps-include-file.html
                                • function.ps-lineto.html
                                • function.ps-makespotcolor.html
                                • function.ps-moveto.html
                                • function.ps-new.html
                                • function.ps-open-file.html
                                • function.ps-open-image-file.html
                                • function.ps-open-image.html
                                • function.ps-open-memory-image.html
                                • function.ps-place-image.html
                                • function.ps-rect.html
                                • function.ps-restore.html
                                • function.ps-rotate.html
                                • function.ps-save.html
                                • function.ps-scale.html
                                • function.ps-set-border-color.html
                                • function.ps-set-border-dash.html
                                • function.ps-set-border-style.html
                                • function.ps-set-info.html
                                • function.ps-set-parameter.html
                                • function.ps-set-text-pos.html
                                • function.ps-set-value.html
                                • function.ps-setcolor.html
                                • function.ps-setdash.html
                                • function.ps-setflat.html
                                • function.ps-setfont.html
                                • function.ps-setgray.html
                                • function.ps-setlinecap.html
                                • function.ps-setlinejoin.html
                                • function.ps-setlinewidth.html
                                • function.ps-setmiterlimit.html
                                • function.ps-setoverprintmode.html
                                • function.ps-setpolydash.html
                                • function.ps-shading-pattern.html
                                • function.ps-shading.html
                                • function.ps-shfill.html
                                • function.ps-show-boxed.html
                                • function.ps-show-xy.html
                                • function.ps-show-xy2.html
                                • function.ps-show.html
                                • function.ps-show2.html
                                • function.ps-string-geometry.html
                                • function.ps-stringwidth.html
                                • function.ps-stroke.html
                                • function.ps-symbol-name.html
                                • function.ps-symbol-width.html
                                • function.ps-symbol.html
                                • function.ps-translate.html
                                • function.pspell-add-to-personal.html
                                • function.pspell-add-to-session.html
                                • function.pspell-check.html
                                • function.pspell-clear-session.html
                                • function.pspell-config-create.html
                                • function.pspell-config-data-dir.html
                                • function.pspell-config-dict-dir.html
                                • function.pspell-config-ignore.html
                                • function.pspell-config-mode.html
                                • function.pspell-config-personal.html
                                • function.pspell-config-repl.html
                                • function.pspell-config-runtogether.html
                                • function.pspell-config-save-repl.html
                                • function.pspell-new-config.html
                                • function.pspell-new-personal.html
                                • function.pspell-new.html
                                • function.pspell-save-wordlist.html
                                • function.pspell-store-replacement.html
                                • function.pspell-suggest.html
                                • function.putenv.html
                                • function.px-close.html
                                • function.px-create-fp.html
                                • function.px-date2string.html
                                • function.px-delete-record.html
                                • function.px-delete.html
                                • function.px-get-field.html
                                • function.px-get-info.html
                                • function.px-get-parameter.html
                                • function.px-get-record.html
                                • function.px-get-schema.html
                                • function.px-get-value.html
                                • function.px-insert-record.html
                                • function.px-new.html
                                • function.px-numfields.html
                                • function.px-numrecords.html
                                • function.px-open-fp.html
                                • function.px-put-record.html
                                • function.px-retrieve-record.html
                                • function.px-set-blob-file.html
                                • function.px-set-parameter.html
                                • function.px-set-tablename.html
                                • function.px-set-targetencoding.html
                                • function.px-set-value.html
                                • function.px-timestamp2string.html
                                • function.px-update-record.html
                                • function.quoted-printable-decode.html
                                • function.quoted-printable-encode.html
                                • function.quotemeta.html
                                • function.rad2deg.html
                                • function.radius-acct-open.html
                                • function.radius-add-server.html
                                • function.radius-auth-open.html
                                • function.radius-close.html
                                • function.radius-config.html
                                • function.radius-create-request.html
                                • function.radius-cvt-addr.html
                                • function.radius-cvt-int.html
                                • function.radius-cvt-string.html
                                • function.radius-demangle-mppe-key.html
                                • function.radius-demangle.html
                                • function.radius-get-attr.html
                                • function.radius-get-tagged-attr-data.html
                                • function.radius-get-tagged-attr-tag.html
                                • function.radius-get-vendor-attr.html
                                • function.radius-put-addr.html
                                • function.radius-put-attr.html
                                • function.radius-put-int.html
                                • function.radius-put-string.html
                                • function.radius-put-vendor-addr.html
                                • function.radius-put-vendor-attr.html
                                • function.radius-put-vendor-int.html
                                • function.radius-put-vendor-string.html
                                • function.radius-request-authenticator.html
                                • function.radius-salt-encrypt-attr.html
                                • function.radius-send-request.html
                                • function.radius-server-secret.html
                                • function.radius-strerror.html
                                • function.rand.html
                                • function.random-bytes.html
                                • function.random-int.html
                                • function.range.html
                                • function.rar-wrapper-cache-stats.html
                                • function.rawurldecode.html
                                • function.rawurlencode.html
                                • function.read-exif-data.html
                                • function.readdir.html
                                • function.readfile.html
                                • function.readgzfile.html
                                • function.readline-add-history.html
                                • function.readline-callback-handler-install.html
                                • function.readline-callback-handler-remove.html
                                • function.readline-callback-read-char.html
                                • function.readline-clear-history.html
                                • function.readline-completion-function.html
                                • function.readline-info.html
                                • function.readline-list-history.html
                                • function.readline-on-new-line.html
                                • function.readline-read-history.html
                                • function.readline-redisplay.html
                                • function.readline-write-history.html
                                • function.readline.html
                                • function.readlink.html
                                • function.realpath-cache-get.html
                                • function.realpath-cache-size.html
                                • function.realpath.html
                                • function.recode-file.html
                                • function.recode-string.html
                                • function.recode.html
                                • function.register-shutdown-function.html
                                • function.register-tick-function.html
                                • function.rename-function.html
                                • function.rename.html
                                • function.require-once.html
                                • function.require.html
                                • function.reset.html
                                • function.restore-error-handler.html
                                • function.restore-exception-handler.html
                                • function.restore-include-path.html
                                • function.return.html
                                • function.rewind.html
                                • function.rewinddir.html
                                • function.rmdir.html
                                • function.round.html
                                • function.rpm-close.html
                                • function.rpm-get-tag.html
                                • function.rpm-is-valid.html
                                • function.rpm-open.html
                                • function.rpm-version.html
                                • function.rrd-create.html
                                • function.rrd-error.html
                                • function.rrd-fetch.html
                                • function.rrd-first.html
                                • function.rrd-graph.html
                                • function.rrd-info.html
                                • function.rrd-last.html
                                • function.rrd-lastupdate.html
                                • function.rrd-restore.html
                                • function.rrd-tune.html
                                • function.rrd-update.html
                                • function.rrd-version.html
                                • function.rrd-xport.html
                                • function.rrdc-disconnect.html
                                • function.rsort.html
                                • function.rtrim.html
                                • function.runkit-class-adopt.html
                                • function.runkit-class-emancipate.html
                                • function.runkit-constant-add.html
                                • function.runkit-constant-redefine.html
                                • function.runkit-constant-remove.html
                                • function.runkit-function-add.html
                                • function.runkit-function-copy.html
                                • function.runkit-function-redefine.html
                                • function.runkit-function-remove.html
                                • function.runkit-function-rename.html
                                • function.runkit-import.html
                                • function.runkit-lint-file.html
                                • function.runkit-lint.html
                                • function.runkit-method-add.html
                                • function.runkit-method-copy.html
                                • function.runkit-method-redefine.html
                                • function.runkit-method-remove.html
                                • function.runkit-method-rename.html
                                • function.runkit-return-value-used.html
                                • function.runkit-sandbox-output-handler.html
                                • function.runkit-superglobals.html
                                • function.scandir.html
                                • function.sem-acquire.html
                                • function.sem-get.html
                                • function.sem-release.html
                                • function.sem-remove.html
                                • function.serialize.html
                                • function.session-abort.html
                                • function.session-cache-expire.html
                                • function.session-cache-limiter.html
                                • function.session-commit.html
                                • function.session-decode.html
                                • function.session-destroy.html
                                • function.session-encode.html
                                • function.session-get-cookie-params.html
                                • function.session-id.html
                                • function.session-is-registered.html
                                • function.session-module-name.html
                                • function.session-name.html
                                • function.session-pgsql-add-error.html
                                • function.session-pgsql-get-error.html
                                • function.session-pgsql-get-field.html
                                • function.session-pgsql-reset.html
                                • function.session-pgsql-set-field.html
                                • function.session-pgsql-status.html
                                • function.session-regenerate-id.html
                                • function.session-register-shutdown.html
                                • function.session-register.html
                                • function.session-reset.html
                                • function.session-save-path.html
                                • function.session-set-cookie-params.html
                                • function.session-set-save-handler.html
                                • function.session-start.html
                                • function.session-status.html
                                • function.session-unregister.html
                                • function.session-unset.html
                                • function.session-write-close.html
                                • function.set-error-handler.html
                                • function.set-exception-handler.html
                                • function.set-file-buffer.html
                                • function.set-include-path.html
                                • function.set-magic-quotes-runtime.html
                                • function.set-socket-blocking.html
                                • function.set-time-limit.html
                                • function.setcookie.html
                                • function.setlocale.html
                                • function.setproctitle.html
                                • function.setrawcookie.html
                                • function.setthreadtitle.html
                                • function.settype.html
                                • function.sha1-file.html
                                • function.sha1.html
                                • function.shell-exec.html
                                • function.shm-attach.html
                                • function.shm-detach.html
                                • function.shm-get-var.html
                                • function.shm-has-var.html
                                • function.shm-put-var.html
                                • function.shm-remove-var.html
                                • function.shm-remove.html
                                • function.shmop-close.html
                                • function.shmop-delete.html
                                • function.shmop-open.html
                                • function.shmop-read.html
                                • function.shmop-size.html
                                • function.shmop-write.html
                                • function.show-source.html
                                • function.shuffle.html
                                • function.signeurlpaiement.html
                                • function.similar-text.html
                                • function.simplexml-import-dom.html
                                • function.simplexml-load-file.html
                                • function.simplexml-load-string.html
                                • function.sin.html
                                • function.sinh.html
                                • function.sizeof.html
                                • function.sleep.html
                                • function.snmp-get-quick-print.html
                                • function.snmp-get-valueretrieval.html
                                • function.snmp-read-mib.html
                                • function.snmp-set-enum-print.html
                                • function.snmp-set-oid-numeric-print.html
                                • function.snmp-set-oid-output-format.html
                                • function.snmp-set-quick-print.html
                                • function.snmp-set-valueretrieval.html
                                • function.snmp2-get.html
                                • function.snmp2-getnext.html
                                • function.snmp2-real-walk.html
                                • function.snmp2-set.html
                                • function.snmp2-walk.html
                                • function.snmp3-get.html
                                • function.snmp3-getnext.html
                                • function.snmp3-real-walk.html
                                • function.snmp3-set.html
                                • function.snmp3-walk.html
                                • function.snmpget.html
                                • function.snmpgetnext.html
                                • function.snmprealwalk.html
                                • function.snmpset.html
                                • function.snmpwalk.html
                                • function.snmpwalkoid.html
                                • function.socket-accept.html
                                • function.socket-bind.html
                                • function.socket-clear-error.html
                                • function.socket-close.html
                                • function.socket-cmsg-space.html
                                • function.socket-connect.html
                                • function.socket-create-listen.html
                                • function.socket-create-pair.html
                                • function.socket-create.html
                                • function.socket-get-option.html
                                • function.socket-get-status.html
                                • function.socket-getopt.html
                                • function.socket-getpeername.html
                                • function.socket-getsockname.html
                                • function.socket-import-stream.html
                                • function.socket-last-error.html
                                • function.socket-listen.html
                                • function.socket-read.html
                                • function.socket-recv.html
                                • function.socket-recvfrom.html
                                • function.socket-recvmsg.html
                                • function.socket-select.html
                                • function.socket-send.html
                                • function.socket-sendmsg.html
                                • function.socket-sendto.html
                                • function.socket-set-block.html
                                • function.socket-set-blocking.html
                                • function.socket-set-nonblock.html
                                • function.socket-set-option.html
                                • function.socket-set-timeout.html
                                • function.socket-setopt.html
                                • function.socket-shutdown.html
                                • function.socket-strerror.html
                                • function.socket-write.html
                                • function.solr-get-version.html
                                • function.sort.html
                                • function.soundex.html
                                • function.spl-autoload-call.html
                                • function.spl-autoload-extensions.html
                                • function.spl-autoload-functions.html
                                • function.spl-autoload-register.html
                                • function.spl-autoload-unregister.html
                                • function.spl-autoload.html
                                • function.spl-classes.html
                                • function.spl-object-hash.html
                                • function.split.html
                                • function.spliti.html
                                • function.sprintf.html
                                • function.sql-regcase.html
                                • function.sqlite-array-query.html
                                • function.sqlite-busy-timeout.html
                                • function.sqlite-changes.html
                                • function.sqlite-close.html
                                • function.sqlite-column.html
                                • function.sqlite-create-aggregate.html
                                • function.sqlite-create-function.html
                                • function.sqlite-current.html
                                • function.sqlite-error-string.html
                                • function.sqlite-escape-string.html
                                • function.sqlite-exec.html
                                • function.sqlite-factory.html
                                • function.sqlite-fetch-all.html
                                • function.sqlite-fetch-array.html
                                • function.sqlite-fetch-column-types.html
                                • function.sqlite-fetch-object.html
                                • function.sqlite-fetch-single.html
                                • function.sqlite-fetch-string.html
                                • function.sqlite-field-name.html
                                • function.sqlite-has-more.html
                                • function.sqlite-has-prev.html
                                • function.sqlite-key.html
                                • function.sqlite-last-error.html
                                • function.sqlite-last-insert-rowid.html
                                • function.sqlite-libencoding.html
                                • function.sqlite-libversion.html
                                • function.sqlite-next.html
                                • function.sqlite-num-fields.html
                                • function.sqlite-num-rows.html
                                • function.sqlite-open.html
                                • function.sqlite-popen.html
                                • function.sqlite-prev.html
                                • function.sqlite-query.html
                                • function.sqlite-rewind.html
                                • function.sqlite-seek.html
                                • function.sqlite-single-query.html
                                • function.sqlite-udf-decode-binary.html
                                • function.sqlite-udf-encode-binary.html
                                • function.sqlite-unbuffered-query.html
                                • function.sqlite-valid.html
                                • function.sqlsrv-begin-transaction.html
                                • function.sqlsrv-cancel.html
                                • function.sqlsrv-client-info.html
                                • function.sqlsrv-close.html
                                • function.sqlsrv-commit.html
                                • function.sqlsrv-configure.html
                                • function.sqlsrv-connect.html
                                • function.sqlsrv-errors.html
                                • function.sqlsrv-execute.html
                                • function.sqlsrv-fetch-array.html
                                • function.sqlsrv-fetch-object.html
                                • function.sqlsrv-fetch.html
                                • function.sqlsrv-field-metadata.html
                                • function.sqlsrv-free-stmt.html
                                • function.sqlsrv-get-config.html
                                • function.sqlsrv-get-field.html
                                • function.sqlsrv-has-rows.html
                                • function.sqlsrv-next-result.html
                                • function.sqlsrv-num-fields.html
                                • function.sqlsrv-num-rows.html
                                • function.sqlsrv-prepare.html
                                • function.sqlsrv-query.html
                                • function.sqlsrv-rollback.html
                                • function.sqlsrv-rows-affected.html
                                • function.sqlsrv-send-stream-data.html
                                • function.sqlsrv-server-info.html
                                • function.sqrt.html
                                • function.srand.html
                                • function.sscanf.html
                                • function.ssdeep-fuzzy-compare.html
                                • function.ssdeep-fuzzy-hash-filename.html
                                • function.ssdeep-fuzzy-hash.html
                                • function.ssh2-auth-agent.html
                                • function.ssh2-auth-hostbased-file.html
                                • function.ssh2-auth-none.html
                                • function.ssh2-auth-password.html
                                • function.ssh2-auth-pubkey-file.html
                                • function.ssh2-connect.html
                                • function.ssh2-exec.html
                                • function.ssh2-fetch-stream.html
                                • function.ssh2-fingerprint.html
                                • function.ssh2-methods-negotiated.html
                                • function.ssh2-publickey-add.html
                                • function.ssh2-publickey-init.html
                                • function.ssh2-publickey-list.html
                                • function.ssh2-publickey-remove.html
                                • function.ssh2-scp-recv.html
                                • function.ssh2-scp-send.html
                                • function.ssh2-sftp-chmod.html
                                • function.ssh2-sftp-lstat.html
                                • function.ssh2-sftp-mkdir.html
                                • function.ssh2-sftp-readlink.html
                                • function.ssh2-sftp-realpath.html
                                • function.ssh2-sftp-rename.html
                                • function.ssh2-sftp-rmdir.html
                                • function.ssh2-sftp-stat.html
                                • function.ssh2-sftp-symlink.html
                                • function.ssh2-sftp-unlink.html
                                • function.ssh2-sftp.html
                                • function.ssh2-shell.html
                                • function.ssh2-tunnel.html
                                • function.stat.html
                                • function.stats-absolute-deviation.html
                                • function.stats-cdf-beta.html
                                • function.stats-cdf-binomial.html
                                • function.stats-cdf-cauchy.html
                                • function.stats-cdf-chisquare.html
                                • function.stats-cdf-exponential.html
                                • function.stats-cdf-f.html
                                • function.stats-cdf-gamma.html
                                • function.stats-cdf-laplace.html
                                • function.stats-cdf-logistic.html
                                • function.stats-cdf-negative-binomial.html
                                • function.stats-cdf-noncentral-chisquare.html
                                • function.stats-cdf-noncentral-f.html
                                • function.stats-cdf-poisson.html
                                • function.stats-cdf-t.html
                                • function.stats-cdf-uniform.html
                                • function.stats-cdf-weibull.html
                                • function.stats-covariance.html
                                • function.stats-den-uniform.html
                                • function.stats-dens-beta.html
                                • function.stats-dens-cauchy.html
                                • function.stats-dens-chisquare.html
                                • function.stats-dens-exponential.html
                                • function.stats-dens-f.html
                                • function.stats-dens-gamma.html
                                • function.stats-dens-laplace.html
                                • function.stats-dens-logistic.html
                                • function.stats-dens-negative-binomial.html
                                • function.stats-dens-normal.html
                                • function.stats-dens-pmf-binomial.html
                                • function.stats-dens-pmf-hypergeometric.html
                                • function.stats-dens-pmf-poisson.html
                                • function.stats-dens-t.html
                                • function.stats-dens-weibull.html
                                • function.stats-harmonic-mean.html
                                • function.stats-kurtosis.html
                                • function.stats-rand-gen-beta.html
                                • function.stats-rand-gen-chisquare.html
                                • function.stats-rand-gen-exponential.html
                                • function.stats-rand-gen-f.html
                                • function.stats-rand-gen-funiform.html
                                • function.stats-rand-gen-gamma.html
                                • function.stats-rand-gen-ibinomial-negative.html
                                • function.stats-rand-gen-ibinomial.html
                                • function.stats-rand-gen-int.html
                                • function.stats-rand-gen-ipoisson.html
                                • function.stats-rand-gen-iuniform.html
                                • function.stats-rand-gen-noncenral-chisquare.html
                                • function.stats-rand-gen-noncentral-f.html
                                • function.stats-rand-gen-noncentral-t.html
                                • function.stats-rand-gen-normal.html
                                • function.stats-rand-gen-t.html
                                • function.stats-rand-get-seeds.html
                                • function.stats-rand-phrase-to-seeds.html
                                • function.stats-rand-ranf.html
                                • function.stats-rand-setall.html
                                • function.stats-skew.html
                                • function.stats-standard-deviation.html
                                • function.stats-stat-binomial-coef.html
                                • function.stats-stat-correlation.html
                                • function.stats-stat-gennch.html
                                • function.stats-stat-independent-t.html
                                • function.stats-stat-innerproduct.html
                                • function.stats-stat-noncentral-t.html
                                • function.stats-stat-paired-t.html
                                • function.stats-stat-percentile.html
                                • function.stats-stat-powersum.html
                                • function.stats-variance.html
                                • function.stomp-connect-error.html
                                • function.stomp-version.html
                                • function.str-getcsv.html
                                • function.str-ireplace.html
                                • function.str-pad.html
                                • function.str-repeat.html
                                • function.str-replace.html
                                • function.str-rot13.html
                                • function.str-shuffle.html
                                • function.str-split.html
                                • function.str-word-count.html
                                • function.strcasecmp.html
                                • function.strchr.html
                                • function.strcmp.html
                                • function.strcoll.html
                                • function.strcspn.html
                                • function.stream-bucket-append.html
                                • function.stream-bucket-make-writeable.html
                                • function.stream-bucket-new.html
                                • function.stream-bucket-prepend.html
                                • function.stream-context-create.html
                                • function.stream-context-get-default.html
                                • function.stream-context-get-options.html
                                • function.stream-context-get-params.html
                                • function.stream-context-set-default.html
                                • function.stream-context-set-option.html
                                • function.stream-context-set-params.html
                                • function.stream-copy-to-stream.html
                                • function.stream-encoding.html
                                • function.stream-filter-append.html
                                • function.stream-filter-prepend.html
                                • function.stream-filter-register.html
                                • function.stream-filter-remove.html
                                • function.stream-get-contents.html
                                • function.stream-get-filters.html
                                • function.stream-get-line.html
                                • function.stream-get-meta-data.html
                                • function.stream-get-transports.html
                                • function.stream-get-wrappers.html
                                • function.stream-is-local.html
                                • function.stream-notification-callback.html
                                • function.stream-register-wrapper.html
                                • function.stream-resolve-include-path.html
                                • function.stream-select.html
                                • function.stream-set-blocking.html
                                • function.stream-set-chunk-size.html
                                • function.stream-set-read-buffer.html
                                • function.stream-set-timeout.html
                                • function.stream-set-write-buffer.html
                                • function.stream-socket-accept.html
                                • function.stream-socket-client.html
                                • function.stream-socket-enable-crypto.html
                                • function.stream-socket-get-name.html
                                • function.stream-socket-pair.html
                                • function.stream-socket-recvfrom.html
                                • function.stream-socket-sendto.html
                                • function.stream-socket-server.html
                                • function.stream-socket-shutdown.html
                                • function.stream-supports-lock.html
                                • function.stream-wrapper-register.html
                                • function.stream-wrapper-restore.html
                                • function.stream-wrapper-unregister.html
                                • function.strftime.html
                                • function.strip-tags.html
                                • function.stripcslashes.html
                                • function.stripos.html
                                • function.stripslashes.html
                                • function.stristr.html
                                • function.strlen.html
                                • function.strnatcasecmp.html
                                • function.strnatcmp.html
                                • function.strncasecmp.html
                                • function.strncmp.html
                                • function.strpbrk.html
                                • function.strpos.html
                                • function.strptime.html
                                • function.strrchr.html
                                • function.strrev.html
                                • function.strripos.html
                                • function.strrpos.html
                                • function.strspn.html
                                • function.strstr.html
                                • function.strtok.html
                                • function.strtolower.html
                                • function.strtotime.html
                                • function.strtoupper.html
                                • function.strtr.html
                                • function.strval.html
                                • function.substr-compare.html
                                • function.substr-count.html
                                • function.substr-replace.html
                                • function.substr.html
                                • function.svn-add.html
                                • function.svn-auth-get-parameter.html
                                • function.svn-auth-set-parameter.html
                                • function.svn-blame.html
                                • function.svn-cat.html
                                • function.svn-checkout.html
                                • function.svn-cleanup.html
                                • function.svn-client-version.html
                                • function.svn-commit.html
                                • function.svn-delete.html
                                • function.svn-diff.html
                                • function.svn-export.html
                                • function.svn-fs-abort-txn.html
                                • function.svn-fs-apply-text.html
                                • function.svn-fs-begin-txn2.html
                                • function.svn-fs-change-node-prop.html
                                • function.svn-fs-check-path.html
                                • function.svn-fs-contents-changed.html
                                • function.svn-fs-copy.html
                                • function.svn-fs-delete.html
                                • function.svn-fs-dir-entries.html
                                • function.svn-fs-file-contents.html
                                • function.svn-fs-file-length.html
                                • function.svn-fs-is-dir.html
                                • function.svn-fs-is-file.html
                                • function.svn-fs-make-dir.html
                                • function.svn-fs-make-file.html
                                • function.svn-fs-node-created-rev.html
                                • function.svn-fs-node-prop.html
                                • function.svn-fs-props-changed.html
                                • function.svn-fs-revision-prop.html
                                • function.svn-fs-revision-root.html
                                • function.svn-fs-txn-root.html
                                • function.svn-fs-youngest-rev.html
                                • function.svn-import.html
                                • function.svn-log.html
                                • function.svn-ls.html
                                • function.svn-mkdir.html
                                • function.svn-repos-create.html
                                • function.svn-repos-fs-begin-txn-for-commit.html
                                • function.svn-repos-fs-commit-txn.html
                                • function.svn-repos-fs.html
                                • function.svn-repos-hotcopy.html
                                • function.svn-repos-open.html
                                • function.svn-repos-recover.html
                                • function.svn-revert.html
                                • function.svn-status.html
                                • function.svn-update.html
                                • function.sybase-affected-rows.html
                                • function.sybase-close.html
                                • function.sybase-connect.html
                                • function.sybase-data-seek.html
                                • function.sybase-deadlock-retry-count.html
                                • function.sybase-fetch-array.html
                                • function.sybase-fetch-assoc.html
                                • function.sybase-fetch-field.html
                                • function.sybase-fetch-object.html
                                • function.sybase-fetch-row.html
                                • function.sybase-field-seek.html
                                • function.sybase-free-result.html
                                • function.sybase-get-last-message.html
                                • function.sybase-min-client-severity.html
                                • function.sybase-min-error-severity.html
                                • function.sybase-min-message-severity.html
                                • function.sybase-min-server-severity.html
                                • function.sybase-num-fields.html
                                • function.sybase-num-rows.html
                                • function.sybase-pconnect.html
                                • function.sybase-query.html
                                • function.sybase-result.html
                                • function.sybase-select-db.html
                                • function.sybase-set-message-handler.html
                                • function.sybase-unbuffered-query.html
                                • function.symlink.html
                                • function.sys-get-temp-dir.html
                                • function.sys-getloadavg.html
                                • function.syslog.html
                                • function.system.html
                                • function.taint.html
                                • function.tan.html
                                • function.tanh.html
                                • function.tcpwrap-check.html
                                • function.tempnam.html
                                • function.textdomain.html
                                • function.tidy-access-count.html
                                • function.tidy-config-count.html
                                • function.tidy-error-count.html
                                • function.tidy-get-output.html
                                • function.tidy-load-config.html
                                • function.tidy-reset-config.html
                                • function.tidy-save-config.html
                                • function.tidy-set-encoding.html
                                • function.tidy-setopt.html
                                • function.tidy-warning-count.html
                                • function.time-nanosleep.html
                                • function.time-sleep-until.html
                                • function.time.html
                                • function.timezone-abbreviations-list.html
                                • function.timezone-identifiers-list.html
                                • function.timezone-location-get.html
                                • function.timezone-name-from-abbr.html
                                • function.timezone-name-get.html
                                • function.timezone-offset-get.html
                                • function.timezone-open.html
                                • function.timezone-transitions-get.html
                                • function.timezone-version-get.html
                                • function.tmpfile.html
                                • function.token-get-all.html
                                • function.token-name.html
                                • function.touch.html
                                • function.trader-acos.html
                                • function.trader-ad.html
                                • function.trader-add.html
                                • function.trader-adosc.html
                                • function.trader-adx.html
                                • function.trader-adxr.html
                                • function.trader-apo.html
                                • function.trader-aroon.html
                                • function.trader-aroonosc.html
                                • function.trader-asin.html
                                • function.trader-atan.html
                                • function.trader-atr.html
                                • function.trader-avgprice.html
                                • function.trader-bbands.html
                                • function.trader-beta.html
                                • function.trader-bop.html
                                • function.trader-cci.html
                                • function.trader-cdl2crows.html
                                • function.trader-cdl3blackcrows.html
                                • function.trader-cdl3inside.html
                                • function.trader-cdl3linestrike.html
                                • function.trader-cdl3outside.html
                                • function.trader-cdl3starsinsouth.html
                                • function.trader-cdl3whitesoldiers.html
                                • function.trader-cdlabandonedbaby.html
                                • function.trader-cdladvanceblock.html
                                • function.trader-cdlbelthold.html
                                • function.trader-cdlbreakaway.html
                                • function.trader-cdlclosingmarubozu.html
                                • function.trader-cdlconcealbabyswall.html
                                • function.trader-cdlcounterattack.html
                                • function.trader-cdldarkcloudcover.html
                                • function.trader-cdldoji.html
                                • function.trader-cdldojistar.html
                                • function.trader-cdldragonflydoji.html
                                • function.trader-cdlengulfing.html
                                • function.trader-cdleveningdojistar.html
                                • function.trader-cdleveningstar.html
                                • function.trader-cdlgapsidesidewhite.html
                                • function.trader-cdlgravestonedoji.html
                                • function.trader-cdlhammer.html
                                • function.trader-cdlhangingman.html
                                • function.trader-cdlharami.html
                                • function.trader-cdlharamicross.html
                                • function.trader-cdlhighwave.html
                                • function.trader-cdlhikkake.html
                                • function.trader-cdlhikkakemod.html
                                • function.trader-cdlhomingpigeon.html
                                • function.trader-cdlidentical3crows.html
                                • function.trader-cdlinneck.html
                                • function.trader-cdlinvertedhammer.html
                                • function.trader-cdlkicking.html
                                • function.trader-cdlkickingbylength.html
                                • function.trader-cdlladderbottom.html
                                • function.trader-cdllongleggeddoji.html
                                • function.trader-cdllongline.html
                                • function.trader-cdlmarubozu.html
                                • function.trader-cdlmatchinglow.html
                                • function.trader-cdlmathold.html
                                • function.trader-cdlmorningdojistar.html
                                • function.trader-cdlmorningstar.html
                                • function.trader-cdlonneck.html
                                • function.trader-cdlpiercing.html
                                • function.trader-cdlrickshawman.html
                                • function.trader-cdlrisefall3methods.html
                                • function.trader-cdlseparatinglines.html
                                • function.trader-cdlshootingstar.html
                                • function.trader-cdlshortline.html
                                • function.trader-cdlspinningtop.html
                                • function.trader-cdlstalledpattern.html
                                • function.trader-cdlsticksandwich.html
                                • function.trader-cdltakuri.html
                                • function.trader-cdltasukigap.html
                                • function.trader-cdlthrusting.html
                                • function.trader-cdltristar.html
                                • function.trader-cdlunique3river.html
                                • function.trader-cdlupsidegap2crows.html
                                • function.trader-cdlxsidegap3methods.html
                                • function.trader-ceil.html
                                • function.trader-cmo.html
                                • function.trader-correl.html
                                • function.trader-cos.html
                                • function.trader-cosh.html
                                • function.trader-dema.html
                                • function.trader-div.html
                                • function.trader-dx.html
                                • function.trader-ema.html
                                • function.trader-errno.html
                                • function.trader-exp.html
                                • function.trader-floor.html
                                • function.trader-get-compat.html
                                • function.trader-get-unstable-period.html
                                • function.trader-ht-dcperiod.html
                                • function.trader-ht-dcphase.html
                                • function.trader-ht-phasor.html
                                • function.trader-ht-sine.html
                                • function.trader-ht-trendline.html
                                • function.trader-ht-trendmode.html
                                • function.trader-kama.html
                                • function.trader-linearreg-angle.html
                                • function.trader-linearreg-intercept.html
                                • function.trader-linearreg-slope.html
                                • function.trader-linearreg.html
                                • function.trader-ln.html
                                • function.trader-log10.html
                                • function.trader-ma.html
                                • function.trader-macd.html
                                • function.trader-macdext.html
                                • function.trader-macdfix.html
                                • function.trader-mama.html
                                • function.trader-mavp.html
                                • function.trader-max.html
                                • function.trader-maxindex.html
                                • function.trader-medprice.html
                                • function.trader-mfi.html
                                • function.trader-midpoint.html
                                • function.trader-midprice.html
                                • function.trader-min.html
                                • function.trader-minindex.html
                                • function.trader-minmax.html
                                • function.trader-minmaxindex.html
                                • function.trader-minus-di.html
                                • function.trader-minus-dm.html
                                • function.trader-mom.html
                                • function.trader-mult.html
                                • function.trader-natr.html
                                • function.trader-obv.html
                                • function.trader-plus-di.html
                                • function.trader-plus-dm.html
                                • function.trader-ppo.html
                                • function.trader-roc.html
                                • function.trader-rocp.html
                                • function.trader-rocr.html
                                • function.trader-rocr100.html
                                • function.trader-rsi.html
                                • function.trader-sar.html
                                • function.trader-sarext.html
                                • function.trader-set-compat.html
                                • function.trader-set-unstable-period.html
                                • function.trader-sin.html
                                • function.trader-sinh.html
                                • function.trader-sma.html
                                • function.trader-sqrt.html
                                • function.trader-stddev.html
                                • function.trader-stoch.html
                                • function.trader-stochf.html
                                • function.trader-stochrsi.html
                                • function.trader-sub.html
                                • function.trader-sum.html
                                • function.trader-t3.html
                                • function.trader-tan.html
                                • function.trader-tanh.html
                                • function.trader-tema.html
                                • function.trader-trange.html
                                • function.trader-trima.html
                                • function.trader-trix.html
                                • function.trader-tsf.html
                                • function.trader-typprice.html
                                • function.trader-ultosc.html
                                • function.trader-var.html
                                • function.trader-wclprice.html
                                • function.trader-willr.html
                                • function.trader-wma.html
                                • function.trait-exists.html
                                • function.trigger-error.html
                                • function.trim.html
                                • function.uasort.html
                                • function.ucfirst.html
                                • function.ucwords.html
                                • function.udm-add-search-limit.html
                                • function.udm-alloc-agent-array.html
                                • function.udm-alloc-agent.html
                                • function.udm-api-version.html
                                • function.udm-cat-list.html
                                • function.udm-cat-path.html
                                • function.udm-check-charset.html
                                • function.udm-clear-search-limits.html
                                • function.udm-crc32.html
                                • function.udm-errno.html
                                • function.udm-error.html
                                • function.udm-find.html
                                • function.udm-free-agent.html
                                • function.udm-free-ispell-data.html
                                • function.udm-free-res.html
                                • function.udm-get-doc-count.html
                                • function.udm-get-res-field.html
                                • function.udm-get-res-param.html
                                • function.udm-hash32.html
                                • function.udm-load-ispell-data.html
                                • function.udm-set-agent-param.html
                                • function.uksort.html
                                • function.umask.html
                                • function.uniqid.html
                                • function.unixtojd.html
                                • function.unlink.html
                                • function.unpack.html
                                • function.unregister-tick-function.html
                                • function.unserialize.html
                                • function.unset.html
                                • function.untaint.html
                                • function.uopz-backup.html
                                • function.uopz-compose.html
                                • function.uopz-copy.html
                                • function.uopz-delete.html
                                • function.uopz-extend.html
                                • function.uopz-flags.html
                                • function.uopz-function.html
                                • function.uopz-implement.html
                                • function.uopz-overload.html
                                • function.uopz-redefine.html
                                • function.uopz-rename.html
                                • function.uopz-restore.html
                                • function.uopz-undefine.html
                                • function.urldecode.html
                                • function.urlencode.html
                                • function.use-soap-error-handler.html
                                • function.user-error.html
                                • function.usleep.html
                                • function.usort.html
                                • function.utf8-decode.html
                                • function.utf8-encode.html
                                • function.var-dump.html
                                • function.var-export.html
                                • function.variant-abs.html
                                • function.variant-add.html
                                • function.variant-and.html
                                • function.variant-cast.html
                                • function.variant-cat.html
                                • function.variant-cmp.html
                                • function.variant-date-from-timestamp.html
                                • function.variant-date-to-timestamp.html
                                • function.variant-div.html
                                • function.variant-eqv.html
                                • function.variant-fix.html
                                • function.variant-get-type.html
                                • function.variant-idiv.html
                                • function.variant-imp.html
                                • function.variant-int.html
                                • function.variant-mod.html
                                • function.variant-mul.html
                                • function.variant-neg.html
                                • function.variant-not.html
                                • function.variant-or.html
                                • function.variant-pow.html
                                • function.variant-round.html
                                • function.variant-set-type.html
                                • function.variant-set.html
                                • function.variant-sub.html
                                • function.variant-xor.html
                                • function.version-compare.html
                                • function.vfprintf.html
                                • function.virtual.html
                                • function.vpopmail-add-alias-domain-ex.html
                                • function.vpopmail-add-alias-domain.html
                                • function.vpopmail-add-domain-ex.html
                                • function.vpopmail-add-domain.html
                                • function.vpopmail-add-user.html
                                • function.vpopmail-alias-add.html
                                • function.vpopmail-alias-del-domain.html
                                • function.vpopmail-alias-del.html
                                • function.vpopmail-alias-get-all.html
                                • function.vpopmail-alias-get.html
                                • function.vpopmail-auth-user.html
                                • function.vpopmail-del-domain-ex.html
                                • function.vpopmail-del-domain.html
                                • function.vpopmail-del-user.html
                                • function.vpopmail-error.html
                                • function.vpopmail-passwd.html
                                • function.vpopmail-set-user-quota.html
                                • function.vprintf.html
                                • function.vsprintf.html
                                • function.wddx-add-vars.html
                                • function.wddx-deserialize.html
                                • function.wddx-packet-end.html
                                • function.wddx-packet-start.html
                                • function.wddx-serialize-value.html
                                • function.wddx-serialize-vars.html
                                • function.win32-continue-service.html
                                • function.win32-create-service.html
                                • function.win32-delete-service.html
                                • function.win32-get-last-control-message.html
                                • function.win32-pause-service.html
                                • function.win32-ps-list-procs.html
                                • function.win32-ps-stat-mem.html
                                • function.win32-ps-stat-proc.html
                                • function.win32-query-service-status.html
                                • function.win32-set-service-status.html
                                • function.win32-start-service-ctrl-dispatcher.html
                                • function.win32-start-service.html
                                • function.win32-stop-service.html
                                • function.wincache-fcache-fileinfo.html
                                • function.wincache-fcache-meminfo.html
                                • function.wincache-lock.html
                                • function.wincache-ocache-fileinfo.html
                                • function.wincache-ocache-meminfo.html
                                • function.wincache-refresh-if-changed.html
                                • function.wincache-rplist-fileinfo.html
                                • function.wincache-rplist-meminfo.html
                                • function.wincache-scache-info.html
                                • function.wincache-scache-meminfo.html
                                • function.wincache-ucache-add.html
                                • function.wincache-ucache-cas.html
                                • function.wincache-ucache-clear.html
                                • function.wincache-ucache-dec.html
                                • function.wincache-ucache-delete.html
                                • function.wincache-ucache-exists.html
                                • function.wincache-ucache-get.html
                                • function.wincache-ucache-inc.html
                                • function.wincache-ucache-info.html
                                • function.wincache-ucache-meminfo.html
                                • function.wincache-ucache-set.html
                                • function.wincache-unlock.html
                                • function.wordwrap.html
                                • function.xattr-get.html
                                • function.xattr-list.html
                                • function.xattr-remove.html
                                • function.xattr-set.html
                                • function.xattr-supported.html
                                • function.xdiff-file-bdiff-size.html
                                • function.xdiff-file-bdiff.html
                                • function.xdiff-file-bpatch.html
                                • function.xdiff-file-diff-binary.html
                                • function.xdiff-file-diff.html
                                • function.xdiff-file-merge3.html
                                • function.xdiff-file-patch-binary.html
                                • function.xdiff-file-patch.html
                                • function.xdiff-file-rabdiff.html
                                • function.xdiff-string-bdiff-size.html
                                • function.xdiff-string-bdiff.html
                                • function.xdiff-string-bpatch.html
                                • function.xdiff-string-diff-binary.html
                                • function.xdiff-string-diff.html
                                • function.xdiff-string-merge3.html
                                • function.xdiff-string-patch-binary.html
                                • function.xdiff-string-patch.html
                                • function.xdiff-string-rabdiff.html
                                • function.xhprof-disable.html
                                • function.xhprof-enable.html
                                • function.xhprof-sample-disable.html
                                • function.xhprof-sample-enable.html
                                • function.xml-error-string.html
                                • function.xml-get-current-byte-index.html
                                • function.xml-get-current-column-number.html
                                • function.xml-get-current-line-number.html
                                • function.xml-get-error-code.html
                                • function.xml-parse-into-struct.html
                                • function.xml-parse.html
                                • function.xml-parser-create-ns.html
                                • function.xml-parser-create.html
                                • function.xml-parser-free.html
                                • function.xml-parser-get-option.html
                                • function.xml-parser-set-option.html
                                • function.xml-set-character-data-handler.html
                                • function.xml-set-default-handler.html
                                • function.xml-set-element-handler.html
                                • function.xml-set-end-namespace-decl-handler.html
                                • function.xml-set-external-entity-ref-handler.html
                                • function.xml-set-notation-decl-handler.html
                                • function.xml-set-object.html
                                • function.xml-set-processing-instruction-handler.html
                                • function.xml-set-start-namespace-decl-handler.html
                                • function.xml-set-unparsed-entity-decl-handler.html
                                • function.xmlrpc-decode-request.html
                                • function.xmlrpc-decode.html
                                • function.xmlrpc-encode-request.html
                                • function.xmlrpc-encode.html
                                • function.xmlrpc-get-type.html
                                • function.xmlrpc-is-fault.html
                                • function.xmlrpc-parse-method-descriptions.html
                                • function.xmlrpc-server-add-introspection-data.html
                                • function.xmlrpc-server-call-method.html
                                • function.xmlrpc-server-create.html
                                • function.xmlrpc-server-destroy.html
                                • function.xmlrpc-server-register-introspection-callback.html
                                • function.xmlrpc-server-register-method.html
                                • function.xmlrpc-set-type.html
                                • function.xmlwriter-end-attribute.html
                                • function.xmlwriter-end-cdata.html
                                • function.xmlwriter-end-comment.html
                                • function.xmlwriter-end-document.html
                                • function.xmlwriter-end-dtd-attlist.html
                                • function.xmlwriter-end-dtd-element.html
                                • function.xmlwriter-end-dtd-entity.html
                                • function.xmlwriter-end-dtd.html
                                • function.xmlwriter-end-element.html
                                • function.xmlwriter-end-pi.html
                                • function.xmlwriter-flush.html
                                • function.xmlwriter-full-end-element.html
                                • function.xmlwriter-open-memory.html
                                • function.xmlwriter-open-uri.html
                                • function.xmlwriter-output-memory.html
                                • function.xmlwriter-set-indent-string.html
                                • function.xmlwriter-set-indent.html
                                • function.xmlwriter-start-attribute-ns.html
                                • function.xmlwriter-start-attribute.html
                                • function.xmlwriter-start-cdata.html
                                • function.xmlwriter-start-comment.html
                                • function.xmlwriter-start-document.html
                                • function.xmlwriter-start-dtd-attlist.html
                                • function.xmlwriter-start-dtd-element.html
                                • function.xmlwriter-start-dtd-entity.html
                                • function.xmlwriter-start-dtd.html
                                • function.xmlwriter-start-element-ns.html
                                • function.xmlwriter-start-element.html
                                • function.xmlwriter-start-pi.html
                                • function.xmlwriter-text.html
                                • function.xmlwriter-write-attribute-ns.html
                                • function.xmlwriter-write-attribute.html
                                • function.xmlwriter-write-cdata.html
                                • function.xmlwriter-write-comment.html
                                • function.xmlwriter-write-dtd-attlist.html
                                • function.xmlwriter-write-dtd-element.html
                                • function.xmlwriter-write-dtd-entity.html
                                • function.xmlwriter-write-dtd.html
                                • function.xmlwriter-write-element-ns.html
                                • function.xmlwriter-write-element.html
                                • function.xmlwriter-write-pi.html
                                • function.xmlwriter-write-raw.html
                                • function.yaml-emit-file.html
                                • function.yaml-emit.html
                                • function.yaml-parse-file.html
                                • function.yaml-parse-url.html
                                • function.yaml-parse.html
                                • function.yaz-addinfo.html
                                • function.yaz-ccl-conf.html
                                • function.yaz-ccl-parse.html
                                • function.yaz-close.html
                                • function.yaz-connect.html
                                • function.yaz-database.html
                                • function.yaz-element.html
                                • function.yaz-errno.html
                                • function.yaz-error.html
                                • function.yaz-es-result.html
                                • function.yaz-es.html
                                • function.yaz-get-option.html
                                • function.yaz-hits.html
                                • function.yaz-itemorder.html
                                • function.yaz-present.html
                                • function.yaz-range.html
                                • function.yaz-record.html
                                • function.yaz-scan-result.html
                                • function.yaz-scan.html
                                • function.yaz-schema.html
                                • function.yaz-search.html
                                • function.yaz-set-option.html
                                • function.yaz-sort.html
                                • function.yaz-syntax.html
                                • function.yaz-wait.html
                                • function.yp-all.html
                                • function.yp-cat.html
                                • function.yp-err-string.html
                                • function.yp-errno.html
                                • function.yp-first.html
                                • function.yp-get-default-domain.html
                                • function.yp-master.html
                                • function.yp-match.html
                                • function.yp-next.html
                                • function.yp-order.html
                                • function.zend-logo-guid.html
                                • function.zend-thread-id.html
                                • function.zend-version.html
                                • function.zip-close.html
                                • function.zip-entry-close.html
                                • function.zip-entry-compressedsize.html
                                • function.zip-entry-compressionmethod.html
                                • function.zip-entry-filesize.html
                                • function.zip-entry-name.html
                                • function.zip-entry-open.html
                                • function.zip-entry-read.html
                                • function.zip-open.html
                                • function.zip-read.html
                                • function.zlib-decode.html
                                • function.zlib-encode.html
                                • function.zlib-get-coding-type.html
                                • functions.anonymous.html
                                • functions.arguments.html
                                • functions.internal.html
                                • functions.returning-values.html
                                • functions.user-defined.html
                                • functions.variable-functions.html
                                • gearman.configuration.html
                                • gearman.constants.html
                                • gearman.examples-reverse-bg.html
                                • gearman.examples-reverse-task.html
                                • gearman.examples-reverse.html
                                • gearman.examples.html
                                • gearman.installation.html
                                • gearman.requirements.html
                                • gearman.resources.html
                                • gearman.setup.html
                                • gearmanclient.addoptions.html
                                • gearmanclient.addserver.html
                                • gearmanclient.addservers.html
                                • gearmanclient.addtask.html
                                • gearmanclient.addtaskbackground.html
                                • gearmanclient.addtaskhigh.html
                                • gearmanclient.addtaskhighbackground.html
                                • gearmanclient.addtasklow.html
                                • gearmanclient.addtasklowbackground.html
                                • gearmanclient.addtaskstatus.html
                                • gearmanclient.clearcallbacks.html
                                • gearmanclient.clone.html
                                • gearmanclient.construct.html
                                • gearmanclient.context.html
                                • gearmanclient.data.html
                                • gearmanclient.do.html
                                • gearmanclient.dobackground.html
                                • gearmanclient.dohigh.html
                                • gearmanclient.dohighbackground.html
                                • gearmanclient.dojobhandle.html
                                • gearmanclient.dolow.html
                                • gearmanclient.dolowbackground.html
                                • gearmanclient.donormal.html
                                • gearmanclient.dostatus.html
                                • gearmanclient.echo.html
                                • gearmanclient.error.html
                                • gearmanclient.geterrno.html
                                • gearmanclient.jobstatus.html
                                • gearmanclient.ping.html
                                • gearmanclient.removeoptions.html
                                • gearmanclient.returncode.html
                                • gearmanclient.runtasks.html
                                • gearmanclient.setclientcallback.html
                                • gearmanclient.setcompletecallback.html
                                • gearmanclient.setcontext.html
                                • gearmanclient.setcreatedcallback.html
                                • gearmanclient.setdata.html
                                • gearmanclient.setdatacallback.html
                                • gearmanclient.setexceptioncallback.html
                                • gearmanclient.setfailcallback.html
                                • gearmanclient.setoptions.html
                                • gearmanclient.setstatuscallback.html
                                • gearmanclient.settimeout.html
                                • gearmanclient.setwarningcallback.html
                                • gearmanclient.setworkloadcallback.html
                                • gearmanclient.timeout.html
                                • gearmanjob.complete.html
                                • gearmanjob.construct.html
                                • gearmanjob.data.html
                                • gearmanjob.exception.html
                                • gearmanjob.fail.html
                                • gearmanjob.functionname.html
                                • gearmanjob.handle.html
                                • gearmanjob.returncode.html
                                • gearmanjob.sendcomplete.html
                                • gearmanjob.senddata.html
                                • gearmanjob.sendexception.html
                                • gearmanjob.sendfail.html
                                • gearmanjob.sendstatus.html
                                • gearmanjob.sendwarning.html
                                • gearmanjob.setreturn.html
                                • gearmanjob.status.html
                                • gearmanjob.unique.html
                                • gearmanjob.warning.html
                                • gearmanjob.workload.html
                                • gearmanjob.workloadsize.html
                                • gearmantask.construct.html
                                • gearmantask.create.html
                                • gearmantask.data.html
                                • gearmantask.datasize.html
                                • gearmantask.function.html
                                • gearmantask.functionname.html
                                • gearmantask.isknown.html
                                • gearmantask.isrunning.html
                                • gearmantask.jobhandle.html
                                • gearmantask.recvdata.html
                                • gearmantask.returncode.html
                                • gearmantask.senddata.html
                                • gearmantask.sendworkload.html
                                • gearmantask.taskdenominator.html
                                • gearmantask.tasknumerator.html
                                • gearmantask.unique.html
                                • gearmantask.uuid.html
                                • gearmanworker.addfunction.html
                                • gearmanworker.addoptions.html
                                • gearmanworker.addserver.html
                                • gearmanworker.addservers.html
                                • gearmanworker.clone.html
                                • gearmanworker.construct.html
                                • gearmanworker.echo.html
                                • gearmanworker.error.html
                                • gearmanworker.geterrno.html
                                • gearmanworker.options.html
                                • gearmanworker.register.html
                                • gearmanworker.removeoptions.html
                                • gearmanworker.returncode.html
                                • gearmanworker.setid.html
                                • gearmanworker.setoptions.html
                                • gearmanworker.settimeout.html
                                • gearmanworker.timeout.html
                                • gearmanworker.unregister.html
                                • gearmanworker.unregisterall.html
                                • gearmanworker.wait.html
                                • gearmanworker.work.html
                                • gender-gender.connect.html
                                • gender-gender.construct.html
                                • gender-gender.country.html
                                • gender-gender.get.html
                                • gender-gender.isnick.html
                                • gender-gender.similarnames.html
                                • gender.example.admin.html
                                • gender.examples.html
                                • gender.installation.html
                                • gender.setup.html
                                • generator.current.html
                                • generator.getreturn.html
                                • generator.key.html
                                • generator.next.html
                                • generator.rewind.html
                                • generator.send.html
                                • generator.throw.html
                                • generator.valid.html
                                • generator.wakeup.html
                                • geoip.configuration.html
                                • geoip.constants.html
                                • geoip.installation.html
                                • geoip.requirements.html
                                • geoip.resources.html
                                • geoip.setup.html
                                • gettext.configuration.html
                                • gettext.constants.html
                                • gettext.installation.html
                                • gettext.requirements.html
                                • gettext.resources.html
                                • gettext.setup.html
                                • getting-started.html
                                • globiterator.construct.html
                                • globiterator.count.html
                                • gmagick.addimage.html
                                • gmagick.addnoiseimage.html
                                • gmagick.annotateimage.html
                                • gmagick.blurimage.html
                                • gmagick.borderimage.html
                                • gmagick.charcoalimage.html
                                • gmagick.chopimage.html
                                • gmagick.clear.html
                                • gmagick.commentimage.html
                                • gmagick.compositeimage.html
                                • gmagick.configuration.html
                                • gmagick.constants.html
                                • gmagick.construct.html
                                • gmagick.cropimage.html
                                • gmagick.cropthumbnailimage.html
                                • gmagick.current.html
                                • gmagick.cyclecolormapimage.html
                                • gmagick.deconstructimages.html
                                • gmagick.despeckleimage.html
                                • gmagick.destroy.html
                                • gmagick.drawimage.html
                                • gmagick.edgeimage.html
                                • gmagick.embossimage.html
                                • gmagick.enhanceimage.html
                                • gmagick.equalizeimage.html
                                • gmagick.examples.html
                                • gmagick.flipimage.html
                                • gmagick.flopimage.html
                                • gmagick.frameimage.html
                                • gmagick.gammaimage.html
                                • gmagick.getcopyright.html
                                • gmagick.getfilename.html
                                • gmagick.getimagebackgroundcolor.html
                                • gmagick.getimageblueprimary.html
                                • gmagick.getimagebordercolor.html
                                • gmagick.getimagechanneldepth.html
                                • gmagick.getimagecolors.html
                                • gmagick.getimagecolorspace.html
                                • gmagick.getimagecompose.html
                                • gmagick.getimagedelay.html
                                • gmagick.getimagedepth.html
                                • gmagick.getimagedispose.html
                                • gmagick.getimageextrema.html
                                • gmagick.getimagefilename.html
                                • gmagick.getimageformat.html
                                • gmagick.getimagegamma.html
                                • gmagick.getimagegreenprimary.html
                                • gmagick.getimageheight.html
                                • gmagick.getimagehistogram.html
                                • gmagick.getimageindex.html
                                • gmagick.getimageinterlacescheme.html
                                • gmagick.getimageiterations.html
                                • gmagick.getimagematte.html
                                • gmagick.getimagemattecolor.html
                                • gmagick.getimageprofile.html
                                • gmagick.getimageredprimary.html
                                • gmagick.getimagerenderingintent.html
                                • gmagick.getimageresolution.html
                                • gmagick.getimagescene.html
                                • gmagick.getimagesignature.html
                                • gmagick.getimagetype.html
                                • gmagick.getimageunits.html
                                • gmagick.getimagewhitepoint.html
                                • gmagick.getimagewidth.html
                                • gmagick.getpackagename.html
                                • gmagick.getquantumdepth.html
                                • gmagick.getreleasedate.html
                                • gmagick.getsamplingfactors.html
                                • gmagick.getsize.html
                                • gmagick.getversion.html
                                • gmagick.hasnextimage.html
                                • gmagick.haspreviousimage.html
                                • gmagick.implodeimage.html
                                • gmagick.installation.html
                                • gmagick.labelimage.html
                                • gmagick.levelimage.html
                                • gmagick.magnifyimage.html
                                • gmagick.mapimage.html
                                • gmagick.medianfilterimage.html
                                • gmagick.minifyimage.html
                                • gmagick.modulateimage.html
                                • gmagick.motionblurimage.html
                                • gmagick.newimage.html
                                • gmagick.nextimage.html
                                • gmagick.normalizeimage.html
                                • gmagick.oilpaintimage.html
                                • gmagick.previousimage.html
                                • gmagick.profileimage.html
                                • gmagick.quantizeimage.html
                                • gmagick.quantizeimages.html
                                • gmagick.queryfontmetrics.html
                                • gmagick.queryfonts.html
                                • gmagick.queryformats.html
                                • gmagick.radialblurimage.html
                                • gmagick.raiseimage.html
                                • gmagick.read.html
                                • gmagick.readimage.html
                                • gmagick.readimageblob.html
                                • gmagick.readimagefile.html
                                • gmagick.reducenoiseimage.html
                                • gmagick.removeimage.html
                                • gmagick.removeimageprofile.html
                                • gmagick.requirements.html
                                • gmagick.resampleimage.html
                                • gmagick.resizeimage.html
                                • gmagick.rollimage.html
                                • gmagick.rotateimage.html
                                • gmagick.scaleimage.html
                                • gmagick.separateimagechannel.html
                                • gmagick.setfilename.html
                                • gmagick.setimagebackgroundcolor.html
                                • gmagick.setimageblueprimary.html
                                • gmagick.setimagebordercolor.html
                                • gmagick.setimagechanneldepth.html
                                • gmagick.setimagecolorspace.html
                                • gmagick.setimagecompose.html
                                • gmagick.setimagedelay.html
                                • gmagick.setimagedepth.html
                                • gmagick.setimagedispose.html
                                • gmagick.setimagefilename.html
                                • gmagick.setimageformat.html
                                • gmagick.setimagegamma.html
                                • gmagick.setimagegreenprimary.html
                                • gmagick.setimageindex.html
                                • gmagick.setimageinterlacescheme.html
                                • gmagick.setimageiterations.html
                                • gmagick.setimageprofile.html
                                • gmagick.setimageredprimary.html
                                • gmagick.setimagerenderingintent.html
                                • gmagick.setimageresolution.html
                                • gmagick.setimagescene.html
                                • gmagick.setimagetype.html
                                • gmagick.setimageunits.html
                                • gmagick.setimagewhitepoint.html
                                • gmagick.setsamplingfactors.html
                                • gmagick.setsize.html
                                • gmagick.setup.html
                                • gmagick.shearimage.html
                                • gmagick.solarizeimage.html
                                • gmagick.spreadimage.html
                                • gmagick.stripimage.html
                                • gmagick.swirlimage.html
                                • gmagick.thumbnailimage.html
                                • gmagick.trimimage.html
                                • gmagick.write.html
                                • gmagick.writeimage.html
                                • gmagickdraw.annotate.html
                                • gmagickdraw.arc.html
                                • gmagickdraw.bezier.html
                                • gmagickdraw.ellipse.html
                                • gmagickdraw.getfillcolor.html
                                • gmagickdraw.getfillopacity.html
                                • gmagickdraw.getfont.html
                                • gmagickdraw.getfontsize.html
                                • gmagickdraw.getfontstyle.html
                                • gmagickdraw.getfontweight.html
                                • gmagickdraw.getstrokecolor.html
                                • gmagickdraw.getstrokeopacity.html
                                • gmagickdraw.getstrokewidth.html
                                • gmagickdraw.gettextdecoration.html
                                • gmagickdraw.gettextencoding.html
                                • gmagickdraw.line.html
                                • gmagickdraw.point.html
                                • gmagickdraw.polygon.html
                                • gmagickdraw.polyline.html
                                • gmagickdraw.rectangle.html
                                • gmagickdraw.rotate.html
                                • gmagickdraw.roundrectangle.html
                                • gmagickdraw.scale.html
                                • gmagickdraw.setfillcolor.html
                                • gmagickdraw.setfillopacity.html
                                • gmagickdraw.setfont.html
                                • gmagickdraw.setfontsize.html
                                • gmagickdraw.setfontstyle.html
                                • gmagickdraw.setfontweight.html
                                • gmagickdraw.setstrokecolor.html
                                • gmagickdraw.setstrokeopacity.html
                                • gmagickdraw.setstrokewidth.html
                                • gmagickdraw.settextdecoration.html
                                • gmagickdraw.settextencoding.html
                                • gmagickpixel.construct.html
                                • gmagickpixel.getcolor.html
                                • gmagickpixel.getcolorcount.html
                                • gmagickpixel.getcolorvalue.html
                                • gmagickpixel.setcolor.html
                                • gmagickpixel.setcolorvalue.html
                                • gmp.configuration.html
                                • gmp.constants.html
                                • gmp.examples.html
                                • gmp.installation.html
                                • gmp.requirements.html
                                • gmp.resources.html
                                • gmp.setup.html
                                • gnupg.configuration.html
                                • gnupg.constants.html
                                • gnupg.examples-clearsign.html
                                • gnupg.examples.html
                                • gnupg.installation.html
                                • gnupg.requirements.html
                                • gnupg.resources.html
                                • gnupg.setup.html
                                • gupnp-service-proxy-send-action.html
                                • gupnp.binary-light.html
                                • gupnp.browsing.html
                                • gupnp.configuration.html
                                • gupnp.constants.html
                                • gupnp.examples.html
                                • gupnp.installation.html
                                • gupnp.requirements.html
                                • gupnp.resources.html
                                • gupnp.setup.html
                                • haru.builtin.encodings.html
                                • haru.builtin.fonts.html
                                • haru.builtin.html
                                • haru.configuration.html
                                • haru.constants.html
                                • haru.examples-basics.html
                                • haru.examples.html
                                • haru.installation.html
                                • haru.requirements.html
                                • haru.resources.html
                                • haru.setup.html
                                • haruannotation.setborderstyle.html
                                • haruannotation.sethighlightmode.html
                                • haruannotation.seticon.html
                                • haruannotation.setopened.html
                                • harudestination.setfit.html
                                • harudestination.setfitb.html
                                • harudestination.setfitbh.html
                                • harudestination.setfitbv.html
                                • harudestination.setfith.html
                                • harudestination.setfitr.html
                                • harudestination.setfitv.html
                                • harudestination.setxyz.html
                                • harudoc.addpage.html
                                • harudoc.addpagelabel.html
                                • harudoc.construct.html
                                • harudoc.createoutline.html
                                • harudoc.getcurrentencoder.html
                                • harudoc.getcurrentpage.html
                                • harudoc.getencoder.html
                                • harudoc.getfont.html
                                • harudoc.getinfoattr.html
                                • harudoc.getpagelayout.html
                                • harudoc.getpagemode.html
                                • harudoc.getstreamsize.html
                                • harudoc.insertpage.html
                                • harudoc.loadjpeg.html
                                • harudoc.loadpng.html
                                • harudoc.loadraw.html
                                • harudoc.loadttc.html
                                • harudoc.loadttf.html
                                • harudoc.loadtype1.html
                                • harudoc.output.html
                                • harudoc.readfromstream.html
                                • harudoc.reseterror.html
                                • harudoc.resetstream.html
                                • harudoc.save.html
                                • harudoc.savetostream.html
                                • harudoc.setcompressionmode.html
                                • harudoc.setcurrentencoder.html
                                • harudoc.setencryptionmode.html
                                • harudoc.setinfoattr.html
                                • harudoc.setinfodateattr.html
                                • harudoc.setopenaction.html
                                • harudoc.setpagelayout.html
                                • harudoc.setpagemode.html
                                • harudoc.setpagesconfiguration.html
                                • harudoc.setpassword.html
                                • harudoc.setpermission.html
                                • harudoc.usecnsencodings.html
                                • harudoc.usecnsfonts.html
                                • harudoc.usecntencodings.html
                                • harudoc.usecntfonts.html
                                • harudoc.usejpencodings.html
                                • harudoc.usejpfonts.html
                                • harudoc.usekrencodings.html
                                • harudoc.usekrfonts.html
                                • haruencoder.getbytetype.html
                                • haruencoder.gettype.html
                                • haruencoder.getunicode.html
                                • haruencoder.getwritingmode.html
                                • harufont.getascent.html
                                • harufont.getcapheight.html
                                • harufont.getdescent.html
                                • harufont.getencodingname.html
                                • harufont.getfontname.html
                                • harufont.gettextwidth.html
                                • harufont.getunicodewidth.html
                                • harufont.getxheight.html
                                • harufont.measuretext.html
                                • haruimage.getbitspercomponent.html
                                • haruimage.getcolorspace.html
                                • haruimage.getheight.html
                                • haruimage.getsize.html
                                • haruimage.getwidth.html
                                • haruimage.setcolormask.html
                                • haruimage.setmaskimage.html
                                • haruoutline.setdestination.html
                                • haruoutline.setopened.html
                                • harupage.arc.html
                                • harupage.begintext.html
                                • harupage.circle.html
                                • harupage.closepath.html
                                • harupage.concat.html
                                • harupage.createdestination.html
                                • harupage.createlinkannotation.html
                                • harupage.createtextannotation.html
                                • harupage.createurlannotation.html
                                • harupage.curveto.html
                                • harupage.curveto2.html
                                • harupage.curveto3.html
                                • harupage.drawimage.html
                                • harupage.ellipse.html
                                • harupage.endpath.html
                                • harupage.endtext.html
                                • harupage.eofill.html
                                • harupage.eofillstroke.html
                                • harupage.fill.html
                                • harupage.fillstroke.html
                                • harupage.getcharspace.html
                                • harupage.getcmykfill.html
                                • harupage.getcmykstroke.html
                                • harupage.getcurrentfont.html
                                • harupage.getcurrentfontsize.html
                                • harupage.getcurrentpos.html
                                • harupage.getcurrenttextpos.html
                                • harupage.getdash.html
                                • harupage.getfillingcolorspace.html
                                • harupage.getflatness.html
                                • harupage.getgmode.html
                                • harupage.getgrayfill.html
                                • harupage.getgraystroke.html
                                • harupage.getheight.html
                                • harupage.gethorizontalscaling.html
                                • harupage.getlinecap.html
                                • harupage.getlinejoin.html
                                • harupage.getlinewidth.html
                                • harupage.getmiterlimit.html
                                • harupage.getrgbfill.html
                                • harupage.getrgbstroke.html
                                • harupage.getstrokingcolorspace.html
                                • harupage.gettextleading.html
                                • harupage.gettextmatrix.html
                                • harupage.gettextrenderingmode.html
                                • harupage.gettextrise.html
                                • harupage.gettextwidth.html
                                • harupage.gettransmatrix.html
                                • harupage.getwidth.html
                                • harupage.getwordspace.html
                                • harupage.lineto.html
                                • harupage.measuretext.html
                                • harupage.movetextpos.html
                                • harupage.moveto.html
                                • harupage.movetonextline.html
                                • harupage.rectangle.html
                                • harupage.setcharspace.html
                                • harupage.setcmykfill.html
                                • harupage.setcmykstroke.html
                                • harupage.setdash.html
                                • harupage.setflatness.html
                                • harupage.setfontandsize.html
                                • harupage.setgrayfill.html
                                • harupage.setgraystroke.html
                                • harupage.setheight.html
                                • harupage.sethorizontalscaling.html
                                • harupage.setlinecap.html
                                • harupage.setlinejoin.html
                                • harupage.setlinewidth.html
                                • harupage.setmiterlimit.html
                                • harupage.setrgbfill.html
                                • harupage.setrgbstroke.html
                                • harupage.setrotate.html
                                • harupage.setsize.html
                                • harupage.setslideshow.html
                                • harupage.settextleading.html
                                • harupage.settextmatrix.html
                                • harupage.settextrenderingmode.html
                                • harupage.settextrise.html
                                • harupage.setwidth.html
                                • harupage.setwordspace.html
                                • harupage.showtext.html
                                • harupage.showtextnextline.html
                                • harupage.stroke.html
                                • harupage.textout.html
                                • harupage.textrect.html
                                • hash.configuration.html
                                • hash.constants.html
                                • hash.installation.html
                                • hash.requirements.html
                                • hash.resources.html
                                • hash.setup.html
                                • history.html
                                • history.php.books.html
                                • history.php.html
                                • history.php.publications.html
                                • history.php.related.html
                                • hrtime-performancecounter.getelapsedticks.html
                                • hrtime-performancecounter.getfrequency.html
                                • hrtime-performancecounter.getlastelapsedticks.html
                                • hrtime-performancecounter.isrunning.html
                                • hrtime-performancecounter.start.html
                                • hrtime-performancecounter.stop.html
                                • hrtime-stopwatch.getelapsedtime.html
                                • hrtime-stopwatch.getlastelapsedtime.html
                                • hrtime.example.basic.html
                                • hrtime.examples.html
                                • hrtime.installation.html
                                • hrtime.setup.html
                                • htscanner.configuration.html
                                • htscanner.installation.html
                                • htscanner.requirements.html
                                • htscanner.resources.html
                                • htscanner.setup.html
                                • http.configuration.html
                                • http.constants.html
                                • http.install.html
                                • http.request.options.html
                                • http.requirements.html
                                • http.resources.html
                                • http.setup.html
                                • httpdeflatestream.construct.html
                                • httpdeflatestream.factory.html
                                • httpdeflatestream.finish.html
                                • httpdeflatestream.flush.html
                                • httpdeflatestream.update.html
                                • httpinflatestream.construct.html
                                • httpinflatestream.factory.html
                                • httpinflatestream.finish.html
                                • httpinflatestream.flush.html
                                • httpinflatestream.update.html
                                • httpmessage.addheaders.html
                                • httpmessage.construct.html
                                • httpmessage.detach.html
                                • httpmessage.factory.html
                                • httpmessage.fromenv.html
                                • httpmessage.fromstring.html
                                • httpmessage.getbody.html
                                • httpmessage.getheader.html
                                • httpmessage.getheaders.html
                                • httpmessage.gethttpversion.html
                                • httpmessage.getparentmessage.html
                                • httpmessage.getrequestmethod.html
                                • httpmessage.getrequesturl.html
                                • httpmessage.getresponsecode.html
                                • httpmessage.getresponsestatus.html
                                • httpmessage.gettype.html
                                • httpmessage.guesscontenttype.html
                                • httpmessage.prepend.html
                                • httpmessage.reverse.html
                                • httpmessage.send.html
                                • httpmessage.setbody.html
                                • httpmessage.setheaders.html
                                • httpmessage.sethttpversion.html
                                • httpmessage.setrequestmethod.html
                                • httpmessage.setrequesturl.html
                                • httpmessage.setresponsecode.html
                                • httpmessage.setresponsestatus.html
                                • httpmessage.settype.html
                                • httpmessage.tomessagetypeobject.html
                                • httpmessage.tostring.html
                                • httpquerystring.construct.html
                                • httpquerystring.get.html
                                • httpquerystring.mod.html
                                • httpquerystring.set.html
                                • httpquerystring.singleton.html
                                • httpquerystring.toarray.html
                                • httpquerystring.tostring.html
                                • httpquerystring.xlate.html
                                • httprequest.addcookies.html
                                • httprequest.addheaders.html
                                • httprequest.addpostfields.html
                                • httprequest.addpostfile.html
                                • httprequest.addputdata.html
                                • httprequest.addquerydata.html
                                • httprequest.addrawpostdata.html
                                • httprequest.addssloptions.html
                                • httprequest.clearhistory.html
                                • httprequest.construct.html
                                • httprequest.enablecookies.html
                                • httprequest.getcontenttype.html
                                • httprequest.getcookies.html
                                • httprequest.getheaders.html
                                • httprequest.gethistory.html
                                • httprequest.getmethod.html
                                • httprequest.getoptions.html
                                • httprequest.getpostfields.html
                                • httprequest.getpostfiles.html
                                • httprequest.getputdata.html
                                • httprequest.getputfile.html
                                • httprequest.getquerydata.html
                                • httprequest.getrawpostdata.html
                                • httprequest.getrawrequestmessage.html
                                • httprequest.getrawresponsemessage.html
                                • httprequest.getrequestmessage.html
                                • httprequest.getresponsebody.html
                                • httprequest.getresponsecode.html
                                • httprequest.getresponsecookies.html
                                • httprequest.getresponsedata.html
                                • httprequest.getresponseheader.html
                                • httprequest.getresponseinfo.html
                                • httprequest.getresponsemessage.html
                                • httprequest.getresponsestatus.html
                                • httprequest.getssloptions.html
                                • httprequest.geturl.html
                                • httprequest.resetcookies.html
                                • httprequest.send.html
                                • httprequest.setbody.html
                                • httprequest.setcontenttype.html
                                • httprequest.setcookies.html
                                • httprequest.setheaders.html
                                • httprequest.setmethod.html
                                • httprequest.setoptions.html
                                • httprequest.setpostfields.html
                                • httprequest.setpostfiles.html
                                • httprequest.setputdata.html
                                • httprequest.setputfile.html
                                • httprequest.setquerydata.html
                                • httprequest.setrawpostdata.html
                                • httprequest.setssloptions.html
                                • httprequest.seturl.html
                                • httprequestpool.attach.html
                                • httprequestpool.construct.html
                                • httprequestpool.destruct.html
                                • httprequestpool.detach.html
                                • httprequestpool.getattachedrequests.html
                                • httprequestpool.getfinishedrequests.html
                                • httprequestpool.reset.html
                                • httprequestpool.send.html
                                • httprequestpool.socketperform.html
                                • httprequestpool.socketselect.html
                                • httpresponse.capture.html
                                • httpresponse.getbuffersize.html
                                • httpresponse.getcache.html
                                • httpresponse.getcachecontrol.html
                                • httpresponse.getcontentdisposition.html
                                • httpresponse.getcontenttype.html
                                • httpresponse.getdata.html
                                • httpresponse.getetag.html
                                • httpresponse.getfile.html
                                • httpresponse.getgzip.html
                                • httpresponse.getheader.html
                                • httpresponse.getlastmodified.html
                                • httpresponse.getrequestbody.html
                                • httpresponse.getrequestbodystream.html
                                • httpresponse.getrequestheaders.html
                                • httpresponse.getstream.html
                                • httpresponse.getthrottledelay.html
                                • httpresponse.guesscontenttype.html
                                • httpresponse.redirect.html
                                • httpresponse.send.html
                                • httpresponse.setbuffersize.html
                                • httpresponse.setcache.html
                                • httpresponse.setcachecontrol.html
                                • httpresponse.setcontentdisposition.html
                                • httpresponse.setcontenttype.html
                                • httpresponse.setdata.html
                                • httpresponse.setetag.html
                                • httpresponse.setfile.html
                                • httpresponse.setgzip.html
                                • httpresponse.setheader.html
                                • httpresponse.setlastmodified.html
                                • httpresponse.setstream.html
                                • httpresponse.setthrottledelay.html
                                • httpresponse.status.html
                                • hwapi.apache-integration.html
                                • hwapi.attribute-key.html
                                • hwapi.attribute-langdepvalue.html
                                • hwapi.attribute-value.html
                                • hwapi.attribute-values.html
                                • hwapi.checkin.html
                                • hwapi.checkout.html
                                • hwapi.children.html
                                • hwapi.configuration.html
                                • hwapi.constants.html
                                • hwapi.content-mimetype.html
                                • hwapi.content-read.html
                                • hwapi.content.html
                                • hwapi.copy.html
                                • hwapi.dbstat.html
                                • hwapi.dcstat.html
                                • hwapi.dstanchors.html
                                • hwapi.dstofsrcanchor.html
                                • hwapi.error-count.html
                                • hwapi.error-reason.html
                                • hwapi.find.html
                                • hwapi.ftstat.html
                                • hwapi.hwstat.html
                                • hwapi.identify.html
                                • hwapi.info.html
                                • hwapi.insert.html
                                • hwapi.insertanchor.html
                                • hwapi.insertcollection.html
                                • hwapi.insertdocument.html
                                • hwapi.installation.html
                                • hwapi.link.html
                                • hwapi.lock.html
                                • hwapi.move.html
                                • hwapi.object-assign.html
                                • hwapi.object-attreditable.html
                                • hwapi.object-count.html
                                • hwapi.object-insert.html
                                • hwapi.object-remove.html
                                • hwapi.object-title.html
                                • hwapi.object-value.html
                                • hwapi.object.html
                                • hwapi.objectbyanchor.html
                                • hwapi.parents.html
                                • hwapi.reason-description.html
                                • hwapi.reason-type.html
                                • hwapi.remove.html
                                • hwapi.replace.html
                                • hwapi.requirements.html
                                • hwapi.resources.html
                                • hwapi.setcommittedversion.html
                                • hwapi.setup.html
                                • hwapi.srcanchors.html
                                • hwapi.srcsofdst.html
                                • hwapi.unlock.html
                                • hwapi.user.html
                                • hwapi.userlist.html
                                • ibase.configuration.html
                                • ibase.constants.html
                                • ibase.installation.html
                                • ibase.requirements.html
                                • ibase.resources.html
                                • ibase.setup.html
                                • ibm-db2.configuration.html
                                • ibm-db2.constants.html
                                • ibm-db2.installation.html
                                • ibm-db2.requirements.html
                                • ibm-db2.resources.html
                                • ibm-db2.setup.html
                                • iconv.configuration.html
                                • iconv.constants.html
                                • iconv.installation.html
                                • iconv.requirements.html
                                • iconv.resources.html
                                • iconv.setup.html
                                • id3.configuration.html
                                • id3.constants.html
                                • id3.installation.html
                                • id3.requirements.html
                                • id3.resources.html
                                • id3.setup.html
                                • id3v2attachedpictureframe.getdescription.html
                                • id3v2attachedpictureframe.getmimetype.html
                                • id3v2attachedpictureframe.gettype.html
                                • id3v2attachedpictureframe.savepicture.html
                                • id3v2attachedpictureframe.setmimetype.html
                                • id3v2attachedpictureframe.setpicture.html
                                • id3v2attachedpictureframe.settype.html
                                • id3v2frame.getsize.html
                                • id3v2frame.tostring.html
                                • id3v2tag.addframe.html
                                • id3v2tag.getframelist.html
                                • ifx.configuration.html
                                • ifx.constants.html
                                • ifx.installation.html
                                • ifx.requirements.html
                                • ifx.resources.html
                                • ifx.setup.html
                                • iisfunc.configuration.html
                                • iisfunc.constants.html
                                • iisfunc.installation.html
                                • iisfunc.requirements.html
                                • iisfunc.resources.html
                                • iisfunc.setup.html
                                • image.configuration.html
                                • image.constants.html
                                • image.examples-png.html
                                • image.examples-watermark.html
                                • image.examples.html
                                • image.examples.merged-watermark.html
                                • image.installation.html
                                • image.requirements.html
                                • image.resources.html
                                • image.setup.html
                                • images
                                  • 0baa1b9fae6aec55bbb73037f3016001-xkcd-goto.png
                                  • 12f37b1c6963c1c5c18f30495416a197-gc-algorithm.png
                                  • 12f37b1c6963c1c5c18f30495416a197-gc-benchmark.png
                                  • 12f37b1c6963c1c5c18f30495416a197-leak-array.png
                                  • 12f37b1c6963c1c5c18f30495416a197-loop-array.png
                                  • 12f37b1c6963c1c5c18f30495416a197-simple-array.png
                                  • 12f37b1c6963c1c5c18f30495416a197-simple-array2.png
                                  • 21009b70229598c6a80eef8b45bf282b-imageantialias.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagearc.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagechar.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagecharup.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagecolorallocatealpha.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagecolortransparent.png
                                  • 21009b70229598c6a80eef8b45bf282b-imageconvolution_emboss.png
                                  • 21009b70229598c6a80eef8b45bf282b-imageconvolution_gaussian.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagecopy.gif
                                  • 21009b70229598c6a80eef8b45bf282b-imagecopyresampled.jpg
                                  • 21009b70229598c6a80eef8b45bf282b-imagecopyresampled_2.jpg
                                  • 21009b70229598c6a80eef8b45bf282b-imagecopyresized.jpg
                                  • 21009b70229598c6a80eef8b45bf282b-imagecreate.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagecreatefromgif.gif
                                  • 21009b70229598c6a80eef8b45bf282b-imagecreatefromjpeg.jpg
                                  • 21009b70229598c6a80eef8b45bf282b-imagecreatefrompng.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagecreatefromstring.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagecreatetruecolor.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagedashedline.png
                                  • 21009b70229598c6a80eef8b45bf282b-imageellipse.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagefill.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagefilledarc.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagefilledellipse.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagefilledpolygon.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagefilledrectangle.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagefilltoborder.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagefilterpixelate.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagefliphorizontal.png
                                  • 21009b70229598c6a80eef8b45bf282b-imageflipvertical.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagejpeg.jpg
                                  • 21009b70229598c6a80eef8b45bf282b-imagelayereffect.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagepolygon.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagerectangle.jpg
                                  • 21009b70229598c6a80eef8b45bf282b-imagerotate.jpg
                                  • 21009b70229598c6a80eef8b45bf282b-imagesetbrush.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagesetpixel.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagesetstyle.jpg
                                  • 21009b70229598c6a80eef8b45bf282b-imagesetthickness.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagesettile.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagestring.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagestringup.png
                                  • 21009b70229598c6a80eef8b45bf282b-imagettftext.png
                                  • 21009b70229598c6a80eef8b45bf282b-watermark-merged.png
                                  • 21009b70229598c6a80eef8b45bf282b-watermarks.png
                                  • 2a34c7f2e658f6ae74f3869f2aa5886f-crypt-text-rendered.svg
                                  • 4fd86c7f1b197d1d954ad0f4b033dc93-yar.png
                                  • 55c7816ef6df6821f05678a68b4e4e63-mymemflow.png
                                  • b4cf2bb34e3c20eebcf8f9e8e7949efd-iis6anonauth.png
                                  • b4cf2bb34e3c20eebcf8f9e8e7949efd-iis6defaultdoc.png
                                  • b4cf2bb34e3c20eebcf8f9e8e7949efd-iis7handlericon.png
                                  • b4cf2bb34e3c20eebcf8f9e8e7949efd-iis7handlermap.png
                                  • b4cf2bb34e3c20eebcf8f9e8e7949efd-iis7vistacgi.png
                                  • b4cf2bb34e3c20eebcf8f9e8e7949efd-iis7w2k8cgi.png
                                  • befd863081615f539082d9ff76bf7b39-zend.01-internal-structure.png
                                  • befd863081615f539082d9ff76bf7b39-zend.04-cross-converter.png
                                  • befd863081615f539082d9ff76bf7b39-zend.05-reference-test.png
                                  • befd863081615f539082d9ff76bf7b39-zend.06-variable-creation.png
                                  • befd863081615f539082d9ff76bf7b39-zend.07-warning-messages.png
                                  • befd863081615f539082d9ff76bf7b39-zend.08-phpinfo-output.png
                                  • befd863081615f539082d9ff76bf7b39-zend.09-execution-info.png
                                  • c0d23d2d6769e53e24a1b3136c064577-adaptiveBlurImage.gif
                                  • c0d23d2d6769e53e24a1b3136c064577-distortImage.png
                                  • c0d23d2d6769e53e24a1b3136c064577-floodfillpaint_intermediate.png
                                  • c0d23d2d6769e53e24a1b3136c064577-floodfillpaint_result.png
                                  • c0d23d2d6769e53e24a1b3136c064577-functionImage_multiplied.png
                                  • c0d23d2d6769e53e24a1b3136c064577-functionImage_polynomial.png
                                  • c0d23d2d6769e53e24a1b3136c064577-functionImage_sinusoidal.png
                                  • c0d23d2d6769e53e24a1b3136c064577-hello_world.png
                                  • c0d23d2d6769e53e24a1b3136c064577-hello_world_reflection.png
                                  • c0d23d2d6769e53e24a1b3136c064577-importimagepixels.jpg
                                  • c0d23d2d6769e53e24a1b3136c064577-php_logo.png
                                  • e88cefb5c3fca5060e2490b9763c4433-readfile.png
                                  • f3bc48edf40d5e3e09a166c7fadc7efb-driver_arch.png
                                  • fa7c5b5f326e3c4a6cc9db19e7edbaf0-xkcd-bobby-tables.png
                                • imagick.adaptiveblurimage.html
                                • imagick.adaptiveresizeimage.html
                                • imagick.adaptivesharpenimage.html
                                • imagick.adaptivethresholdimage.html
                                • imagick.addimage.html
                                • imagick.addnoiseimage.html
                                • imagick.affinetransformimage.html
                                • imagick.animateimages.html
                                • imagick.annotateimage.html
                                • imagick.appendimages.html
                                • imagick.autolevelimage.html
                                • imagick.averageimages.html
                                • imagick.blackthresholdimage.html
                                • imagick.blueshiftimage.html
                                • imagick.blurimage.html
                                • imagick.borderimage.html
                                • imagick.brightnesscontrastimage.html
                                • imagick.charcoalimage.html
                                • imagick.chopimage.html
                                • imagick.clampimage.html
                                • imagick.clear.html
                                • imagick.clipimage.html
                                • imagick.clipimagepath.html
                                • imagick.clippathimage.html
                                • imagick.clone.html
                                • imagick.clutimage.html
                                • imagick.coalesceimages.html
                                • imagick.colorfloodfillimage.html
                                • imagick.colorizeimage.html
                                • imagick.colormatriximage.html
                                • imagick.combineimages.html
                                • imagick.commentimage.html
                                • imagick.compareimagechannels.html
                                • imagick.compareimagelayers.html
                                • imagick.compareimages.html
                                • imagick.compositeimage.html
                                • imagick.configuration.html
                                • imagick.constants.html
                                • imagick.construct.html
                                • imagick.contrastimage.html
                                • imagick.contraststretchimage.html
                                • imagick.convolveimage.html
                                • imagick.count.html
                                • imagick.cropimage.html
                                • imagick.cropthumbnailimage.html
                                • imagick.current.html
                                • imagick.cyclecolormapimage.html
                                • imagick.decipherimage.html
                                • imagick.deconstructimages.html
                                • imagick.deleteimageartifact.html
                                • imagick.deleteimageproperty.html
                                • imagick.deskewimage.html
                                • imagick.despeckleimage.html
                                • imagick.destroy.html
                                • imagick.displayimage.html
                                • imagick.displayimages.html
                                • imagick.distortimage.html
                                • imagick.drawimage.html
                                • imagick.edgeimage.html
                                • imagick.embossimage.html
                                • imagick.encipherimage.html
                                • imagick.enhanceimage.html
                                • imagick.equalizeimage.html
                                • imagick.evaluateimage.html
                                • imagick.examples-1.html
                                • imagick.examples.html
                                • imagick.exportimagepixels.html
                                • imagick.extentimage.html
                                • imagick.filter.html
                                • imagick.flattenimages.html
                                • imagick.flipimage.html
                                • imagick.floodfillpaintimage.html
                                • imagick.flopimage.html
                                • imagick.forwardfouriertransformimage.html
                                • imagick.frameimage.html
                                • imagick.functionimage.html
                                • imagick.fximage.html
                                • imagick.gammaimage.html
                                • imagick.gaussianblurimage.html
                                • imagick.getcolorspace.html
                                • imagick.getcompression.html
                                • imagick.getcompressionquality.html
                                • imagick.getcopyright.html
                                • imagick.getfilename.html
                                • imagick.getfont.html
                                • imagick.getformat.html
                                • imagick.getgravity.html
                                • imagick.gethomeurl.html
                                • imagick.getimage.html
                                • imagick.getimagealphachannel.html
                                • imagick.getimageartifact.html
                                • imagick.getimageattribute.html
                                • imagick.getimagebackgroundcolor.html
                                • imagick.getimageblob.html
                                • imagick.getimageblueprimary.html
                                • imagick.getimagebordercolor.html
                                • imagick.getimagechanneldepth.html
                                • imagick.getimagechanneldistortion.html
                                • imagick.getimagechanneldistortions.html
                                • imagick.getimagechannelextrema.html
                                • imagick.getimagechannelkurtosis.html
                                • imagick.getimagechannelmean.html
                                • imagick.getimagechannelrange.html
                                • imagick.getimagechannelstatistics.html
                                • imagick.getimageclipmask.html
                                • imagick.getimagecolormapcolor.html
                                • imagick.getimagecolors.html
                                • imagick.getimagecolorspace.html
                                • imagick.getimagecompose.html
                                • imagick.getimagecompression.html
                                • imagick.getimagecompressionquality.html
                                • imagick.getimagedelay.html
                                • imagick.getimagedepth.html
                                • imagick.getimagedispose.html
                                • imagick.getimagedistortion.html
                                • imagick.getimageextrema.html
                                • imagick.getimagefilename.html
                                • imagick.getimageformat.html
                                • imagick.getimagegamma.html
                                • imagick.getimagegeometry.html
                                • imagick.getimagegravity.html
                                • imagick.getimagegreenprimary.html
                                • imagick.getimageheight.html
                                • imagick.getimagehistogram.html
                                • imagick.getimageindex.html
                                • imagick.getimageinterlacescheme.html
                                • imagick.getimageinterpolatemethod.html
                                • imagick.getimageiterations.html
                                • imagick.getimagelength.html
                                • imagick.getimagemagicklicense.html
                                • imagick.getimagematte.html
                                • imagick.getimagemattecolor.html
                                • imagick.getimagemimetype.html
                                • imagick.getimageorientation.html
                                • imagick.getimagepage.html
                                • imagick.getimagepixelcolor.html
                                • imagick.getimageprofile.html
                                • imagick.getimageprofiles.html
                                • imagick.getimageproperties.html
                                • imagick.getimageproperty.html
                                • imagick.getimageredprimary.html
                                • imagick.getimageregion.html
                                • imagick.getimagerenderingintent.html
                                • imagick.getimageresolution.html
                                • imagick.getimagesblob.html
                                • imagick.getimagescene.html
                                • imagick.getimagesignature.html
                                • imagick.getimagesize.html
                                • imagick.getimagetickspersecond.html
                                • imagick.getimagetotalinkdensity.html
                                • imagick.getimagetype.html
                                • imagick.getimageunits.html
                                • imagick.getimagevirtualpixelmethod.html
                                • imagick.getimagewhitepoint.html
                                • imagick.getimagewidth.html
                                • imagick.getinterlacescheme.html
                                • imagick.getiteratorindex.html
                                • imagick.getnumberimages.html
                                • imagick.getoption.html
                                • imagick.getpackagename.html
                                • imagick.getpage.html
                                • imagick.getpixeliterator.html
                                • imagick.getpixelregioniterator.html
                                • imagick.getpointsize.html
                                • imagick.getquantum.html
                                • imagick.getquantumdepth.html
                                • imagick.getquantumrange.html
                                • imagick.getregistry.html
                                • imagick.getreleasedate.html
                                • imagick.getresource.html
                                • imagick.getresourcelimit.html
                                • imagick.getsamplingfactors.html
                                • imagick.getsize.html
                                • imagick.getsizeoffset.html
                                • imagick.getversion.html
                                • imagick.haldclutimage.html
                                • imagick.hasnextimage.html
                                • imagick.haspreviousimage.html
                                • imagick.identifyformat.html
                                • imagick.identifyimage.html
                                • imagick.implodeimage.html
                                • imagick.importimagepixels.html
                                • imagick.installation.html
                                • imagick.inversefouriertransformimage.html
                                • imagick.labelimage.html
                                • imagick.levelimage.html
                                • imagick.linearstretchimage.html
                                • imagick.liquidrescaleimage.html
                                • imagick.listregistry.html
                                • imagick.magnifyimage.html
                                • imagick.mapimage.html
                                • imagick.mattefloodfillimage.html
                                • imagick.medianfilterimage.html
                                • imagick.mergeimagelayers.html
                                • imagick.minifyimage.html
                                • imagick.modulateimage.html
                                • imagick.montageimage.html
                                • imagick.morphimages.html
                                • imagick.morphology.html
                                • imagick.mosaicimages.html
                                • imagick.motionblurimage.html
                                • imagick.negateimage.html
                                • imagick.newimage.html
                                • imagick.newpseudoimage.html
                                • imagick.nextimage.html
                                • imagick.normalizeimage.html
                                • imagick.oilpaintimage.html
                                • imagick.opaquepaintimage.html
                                • imagick.optimizeimagelayers.html
                                • imagick.orderedposterizeimage.html
                                • imagick.paintfloodfillimage.html
                                • imagick.paintopaqueimage.html
                                • imagick.painttransparentimage.html
                                • imagick.pingimage.html
                                • imagick.pingimageblob.html
                                • imagick.pingimagefile.html
                                • imagick.polaroidimage.html
                                • imagick.posterizeimage.html
                                • imagick.previewimages.html
                                • imagick.previousimage.html
                                • imagick.profileimage.html
                                • imagick.quantizeimage.html
                                • imagick.quantizeimages.html
                                • imagick.queryfontmetrics.html
                                • imagick.queryfonts.html
                                • imagick.queryformats.html
                                • imagick.radialblurimage.html
                                • imagick.raiseimage.html
                                • imagick.randomthresholdimage.html
                                • imagick.readimage.html
                                • imagick.readimageblob.html
                                • imagick.readimagefile.html
                                • imagick.readimages.html
                                • imagick.recolorimage.html
                                • imagick.reducenoiseimage.html
                                • imagick.remapimage.html
                                • imagick.removeimage.html
                                • imagick.removeimageprofile.html
                                • imagick.render.html
                                • imagick.requirements.html
                                • imagick.resampleimage.html
                                • imagick.resetimagepage.html
                                • imagick.resizeimage.html
                                • imagick.resources.html
                                • imagick.rollimage.html
                                • imagick.rotateimage.html
                                • imagick.rotationalblurimage.html
                                • imagick.roundcorners.html
                                • imagick.sampleimage.html
                                • imagick.scaleimage.html
                                • imagick.segmentimage.html
                                • imagick.selectiveblurimage.html
                                • imagick.separateimagechannel.html
                                • imagick.sepiatoneimage.html
                                • imagick.setbackgroundcolor.html
                                • imagick.setcolorspace.html
                                • imagick.setcompression.html
                                • imagick.setcompressionquality.html
                                • imagick.setfilename.html
                                • imagick.setfirstiterator.html
                                • imagick.setfont.html
                                • imagick.setformat.html
                                • imagick.setgravity.html
                                • imagick.setimage.html
                                • imagick.setimagealphachannel.html
                                • imagick.setimageartifact.html
                                • imagick.setimageattribute.html
                                • imagick.setimagebackgroundcolor.html
                                • imagick.setimagebias.html
                                • imagick.setimagebiasquantum.html
                                • imagick.setimageblueprimary.html
                                • imagick.setimagebordercolor.html
                                • imagick.setimagechanneldepth.html
                                • imagick.setimageclipmask.html
                                • imagick.setimagecolormapcolor.html
                                • imagick.setimagecolorspace.html
                                • imagick.setimagecompose.html
                                • imagick.setimagecompression.html
                                • imagick.setimagecompressionquality.html
                                • imagick.setimagedelay.html
                                • imagick.setimagedepth.html
                                • imagick.setimagedispose.html
                                • imagick.setimageextent.html
                                • imagick.setimagefilename.html
                                • imagick.setimageformat.html
                                • imagick.setimagegamma.html
                                • imagick.setimagegravity.html
                                • imagick.setimagegreenprimary.html
                                • imagick.setimageindex.html
                                • imagick.setimageinterlacescheme.html
                                • imagick.setimageinterpolatemethod.html
                                • imagick.setimageiterations.html
                                • imagick.setimagematte.html
                                • imagick.setimagemattecolor.html
                                • imagick.setimageopacity.html
                                • imagick.setimageorientation.html
                                • imagick.setimagepage.html
                                • imagick.setimageprofile.html
                                • imagick.setimageproperty.html
                                • imagick.setimageredprimary.html
                                • imagick.setimagerenderingintent.html
                                • imagick.setimageresolution.html
                                • imagick.setimagescene.html
                                • imagick.setimagetickspersecond.html
                                • imagick.setimagetype.html
                                • imagick.setimageunits.html
                                • imagick.setimagevirtualpixelmethod.html
                                • imagick.setimagewhitepoint.html
                                • imagick.setinterlacescheme.html
                                • imagick.setiteratorindex.html
                                • imagick.setlastiterator.html
                                • imagick.setoption.html
                                • imagick.setpage.html
                                • imagick.setpointsize.html
                                • imagick.setprogressmonitor.html
                                • imagick.setregistry.html
                                • imagick.setresolution.html
                                • imagick.setresourcelimit.html
                                • imagick.setsamplingfactors.html
                                • imagick.setsize.html
                                • imagick.setsizeoffset.html
                                • imagick.settype.html
                                • imagick.setup.html
                                • imagick.shadeimage.html
                                • imagick.shadowimage.html
                                • imagick.sharpenimage.html
                                • imagick.shaveimage.html
                                • imagick.shearimage.html
                                • imagick.sigmoidalcontrastimage.html
                                • imagick.sketchimage.html
                                • imagick.smushimages.html
                                • imagick.solarizeimage.html
                                • imagick.sparsecolorimage.html
                                • imagick.spliceimage.html
                                • imagick.spreadimage.html
                                • imagick.statisticimage.html
                                • imagick.steganoimage.html
                                • imagick.stereoimage.html
                                • imagick.stripimage.html
                                • imagick.subimagematch.html
                                • imagick.swirlimage.html
                                • imagick.textureimage.html
                                • imagick.thresholdimage.html
                                • imagick.thumbnailimage.html
                                • imagick.tintimage.html
                                • imagick.tostring.html
                                • imagick.transformimage.html
                                • imagick.transformimagecolorspace.html
                                • imagick.transparentpaintimage.html
                                • imagick.transposeimage.html
                                • imagick.transverseimage.html
                                • imagick.trimimage.html
                                • imagick.uniqueimagecolors.html
                                • imagick.unsharpmaskimage.html
                                • imagick.valid.html
                                • imagick.vignetteimage.html
                                • imagick.waveimage.html
                                • imagick.whitethresholdimage.html
                                • imagick.writeimage.html
                                • imagick.writeimagefile.html
                                • imagick.writeimages.html
                                • imagick.writeimagesfile.html
                                • imagickdraw.affine.html
                                • imagickdraw.annotation.html
                                • imagickdraw.arc.html
                                • imagickdraw.bezier.html
                                • imagickdraw.circle.html
                                • imagickdraw.clear.html
                                • imagickdraw.clone.html
                                • imagickdraw.color.html
                                • imagickdraw.comment.html
                                • imagickdraw.composite.html
                                • imagickdraw.construct.html
                                • imagickdraw.destroy.html
                                • imagickdraw.ellipse.html
                                • imagickdraw.getclippath.html
                                • imagickdraw.getcliprule.html
                                • imagickdraw.getclipunits.html
                                • imagickdraw.getfillcolor.html
                                • imagickdraw.getfillopacity.html
                                • imagickdraw.getfillrule.html
                                • imagickdraw.getfont.html
                                • imagickdraw.getfontfamily.html
                                • imagickdraw.getfontsize.html
                                • imagickdraw.getfontstretch.html
                                • imagickdraw.getfontstyle.html
                                • imagickdraw.getfontweight.html
                                • imagickdraw.getgravity.html
                                • imagickdraw.getstrokeantialias.html
                                • imagickdraw.getstrokecolor.html
                                • imagickdraw.getstrokedasharray.html
                                • imagickdraw.getstrokedashoffset.html
                                • imagickdraw.getstrokelinecap.html
                                • imagickdraw.getstrokelinejoin.html
                                • imagickdraw.getstrokemiterlimit.html
                                • imagickdraw.getstrokeopacity.html
                                • imagickdraw.getstrokewidth.html
                                • imagickdraw.gettextalignment.html
                                • imagickdraw.gettextantialias.html
                                • imagickdraw.gettextdecoration.html
                                • imagickdraw.gettextencoding.html
                                • imagickdraw.gettextinterlinespacing.html
                                • imagickdraw.gettextinterwordspacing.html
                                • imagickdraw.gettextkerning.html
                                • imagickdraw.gettextundercolor.html
                                • imagickdraw.getvectorgraphics.html
                                • imagickdraw.line.html
                                • imagickdraw.matte.html
                                • imagickdraw.pathclose.html
                                • imagickdraw.pathcurvetoabsolute.html
                                • imagickdraw.pathcurvetoquadraticbezierabsolute.html
                                • imagickdraw.pathcurvetoquadraticbezierrelative.html
                                • imagickdraw.pathcurvetoquadraticbeziersmoothabsolute.html
                                • imagickdraw.pathcurvetoquadraticbeziersmoothrelative.html
                                • imagickdraw.pathcurvetorelative.html
                                • imagickdraw.pathcurvetosmoothabsolute.html
                                • imagickdraw.pathcurvetosmoothrelative.html
                                • imagickdraw.pathellipticarcabsolute.html
                                • imagickdraw.pathellipticarcrelative.html
                                • imagickdraw.pathfinish.html
                                • imagickdraw.pathlinetoabsolute.html
                                • imagickdraw.pathlinetohorizontalabsolute.html
                                • imagickdraw.pathlinetohorizontalrelative.html
                                • imagickdraw.pathlinetorelative.html
                                • imagickdraw.pathlinetoverticalabsolute.html
                                • imagickdraw.pathlinetoverticalrelative.html
                                • imagickdraw.pathmovetoabsolute.html
                                • imagickdraw.pathmovetorelative.html
                                • imagickdraw.pathstart.html
                                • imagickdraw.point.html
                                • imagickdraw.polygon.html
                                • imagickdraw.polyline.html
                                • imagickdraw.pop.html
                                • imagickdraw.popclippath.html
                                • imagickdraw.popdefs.html
                                • imagickdraw.poppattern.html
                                • imagickdraw.push.html
                                • imagickdraw.pushclippath.html
                                • imagickdraw.pushdefs.html
                                • imagickdraw.pushpattern.html
                                • imagickdraw.rectangle.html
                                • imagickdraw.render.html
                                • imagickdraw.resetvectorgraphics.html
                                • imagickdraw.rotate.html
                                • imagickdraw.roundrectangle.html
                                • imagickdraw.scale.html
                                • imagickdraw.setclippath.html
                                • imagickdraw.setcliprule.html
                                • imagickdraw.setclipunits.html
                                • imagickdraw.setfillalpha.html
                                • imagickdraw.setfillcolor.html
                                • imagickdraw.setfillopacity.html
                                • imagickdraw.setfillpatternurl.html
                                • imagickdraw.setfillrule.html
                                • imagickdraw.setfont.html
                                • imagickdraw.setfontfamily.html
                                • imagickdraw.setfontsize.html
                                • imagickdraw.setfontstretch.html
                                • imagickdraw.setfontstyle.html
                                • imagickdraw.setfontweight.html
                                • imagickdraw.setgravity.html
                                • imagickdraw.setresolution.html
                                • imagickdraw.setstrokealpha.html
                                • imagickdraw.setstrokeantialias.html
                                • imagickdraw.setstrokecolor.html
                                • imagickdraw.setstrokedasharray.html
                                • imagickdraw.setstrokedashoffset.html
                                • imagickdraw.setstrokelinecap.html
                                • imagickdraw.setstrokelinejoin.html
                                • imagickdraw.setstrokemiterlimit.html
                                • imagickdraw.setstrokeopacity.html
                                • imagickdraw.setstrokepatternurl.html
                                • imagickdraw.setstrokewidth.html
                                • imagickdraw.settextalignment.html
                                • imagickdraw.settextantialias.html
                                • imagickdraw.settextdecoration.html
                                • imagickdraw.settextencoding.html
                                • imagickdraw.settextinterlinespacing.html
                                • imagickdraw.settextinterwordspacing.html
                                • imagickdraw.settextkerning.html
                                • imagickdraw.settextundercolor.html
                                • imagickdraw.setvectorgraphics.html
                                • imagickdraw.setviewbox.html
                                • imagickdraw.skewx.html
                                • imagickdraw.skewy.html
                                • imagickdraw.translate.html
                                • imagickkernel.addkernel.html
                                • imagickkernel.addunitykernel.html
                                • imagickkernel.frombuiltin.html
                                • imagickkernel.frommatrix.html
                                • imagickkernel.getmatrix.html
                                • imagickkernel.scale.html
                                • imagickkernel.separate.html
                                • imagickpixel.clear.html
                                • imagickpixel.construct.html
                                • imagickpixel.destroy.html
                                • imagickpixel.getcolor.html
                                • imagickpixel.getcolorasstring.html
                                • imagickpixel.getcolorcount.html
                                • imagickpixel.getcolorquantum.html
                                • imagickpixel.getcolorvalue.html
                                • imagickpixel.getcolorvaluequantum.html
                                • imagickpixel.gethsl.html
                                • imagickpixel.getindex.html
                                • imagickpixel.ispixelsimilar.html
                                • imagickpixel.ispixelsimilarquantum.html
                                • imagickpixel.issimilar.html
                                • imagickpixel.setcolor.html
                                • imagickpixel.setcolorcount.html
                                • imagickpixel.setcolorvalue.html
                                • imagickpixel.setcolorvaluequantum.html
                                • imagickpixel.sethsl.html
                                • imagickpixel.setindex.html
                                • imagickpixeliterator.clear.html
                                • imagickpixeliterator.construct.html
                                • imagickpixeliterator.destroy.html
                                • imagickpixeliterator.getcurrentiteratorrow.html
                                • imagickpixeliterator.getiteratorrow.html
                                • imagickpixeliterator.getnextiteratorrow.html
                                • imagickpixeliterator.getpreviousiteratorrow.html
                                • imagickpixeliterator.newpixeliterator.html
                                • imagickpixeliterator.newpixelregioniterator.html
                                • imagickpixeliterator.resetiterator.html
                                • imagickpixeliterator.setiteratorfirstrow.html
                                • imagickpixeliterator.setiteratorlastrow.html
                                • imagickpixeliterator.setiteratorrow.html
                                • imagickpixeliterator.synciterator.html
                                • imap.configuration.html
                                • imap.constants.html
                                • imap.installation.html
                                • imap.requirements.html
                                • imap.resources.html
                                • imap.setup.html
                                • inclued.configuration.html
                                • inclued.constants.html
                                • inclued.examples-implementation.html
                                • inclued.examples.html
                                • inclued.installation.html
                                • inclued.requirements.html
                                • inclued.resources.html
                                • inclued.setup.html
                                • index.html
                                • indexes.examples.html
                                • indexes.functions.html
                                • indexes.html
                                • infiniteiterator.construct.html
                                • infiniteiterator.next.html
                                • info.configuration.html
                                • info.constants.html
                                • info.installation.html
                                • info.requirements.html
                                • info.resources.html
                                • info.setup.html
                                • ingres.configuration.html
                                • ingres.constants.html
                                • ingres.examples-basic.html
                                • ingres.examples.html
                                • ingres.installation.html
                                • ingres.requirements.html
                                • ingres.resources.html
                                • ingres.setup.html
                                • ini.core.html
                                • ini.html
                                • ini.list.html
                                • ini.sect.safe-mode.html
                                • ini.sections.html
                                • inotify.configuration.html
                                • inotify.constants.html
                                • inotify.install.html
                                • inotify.requirements.html
                                • inotify.resources.html
                                • inotify.setup.html
                                • install.cloud.azure.html
                                • install.cloud.ec2.html
                                • install.cloud.html
                                • install.fpm.configuration.html
                                • install.fpm.html
                                • install.fpm.install.html
                                • install.general.html
                                • install.html
                                • install.macosx.bundled.html
                                • install.macosx.compile.html
                                • install.macosx.html
                                • install.macosx.packages.html
                                • install.pecl.downloads.html
                                • install.pecl.html
                                • install.pecl.intro.html
                                • install.pecl.pear.html
                                • install.pecl.php-config.html
                                • install.pecl.phpize.html
                                • install.pecl.static.html
                                • install.pecl.windows.html
                                • install.problems.bugs.html
                                • install.problems.faq.html
                                • install.problems.html
                                • install.problems.support.html
                                • install.unix.apache.html
                                • install.unix.apache2.html
                                • install.unix.commandline.html
                                • install.unix.debian.html
                                • install.unix.hpux.html
                                • install.unix.html
                                • install.unix.lighttpd-14.html
                                • install.unix.nginx.html
                                • install.unix.openbsd.html
                                • install.unix.solaris.html
                                • install.unix.sun.html
                                • install.windows.apache1.html
                                • install.windows.apache2.html
                                • install.windows.building.html
                                • install.windows.commandline.html
                                • install.windows.extensions.html
                                • install.windows.html
                                • install.windows.iis.html
                                • install.windows.iis6.html
                                • install.windows.iis7.html
                                • install.windows.manual.html
                                • install.windows.sambar.html
                                • install.windows.sun.html
                                • install.windows.xitami.html
                                • internals2.apiref.html
                                • internals2.buildsys.configunix.html
                                • internals2.buildsys.configwin.html
                                • internals2.buildsys.environment.html
                                • internals2.buildsys.html
                                • internals2.buildsys.skeleton.html
                                • internals2.classes.html
                                • internals2.counter.basic-interface.html
                                • internals2.counter.constants.html
                                • internals2.counter.counter-class.bumpvalue.html
                                • internals2.counter.counter-class.construct.html
                                • internals2.counter.counter-class.getmeta.html
                                • internals2.counter.counter-class.getnamed.html
                                • internals2.counter.counter-class.getvalue.html
                                • internals2.counter.counter-class.html
                                • internals2.counter.counter-class.resetvalue.html
                                • internals2.counter.counter-class.setcounterclass.html
                                • internals2.counter.examples.basic.html
                                • internals2.counter.examples.extended.html
                                • internals2.counter.examples.html
                                • internals2.counter.examples.objective.html
                                • internals2.counter.extended-interface.html
                                • internals2.counter.function.counter-bump-value.html
                                • internals2.counter.function.counter-bump.html
                                • internals2.counter.function.counter-create.html
                                • internals2.counter.function.counter-get-meta.html
                                • internals2.counter.function.counter-get-named.html
                                • internals2.counter.function.counter-get-value.html
                                • internals2.counter.function.counter-get.html
                                • internals2.counter.function.counter-reset-value.html
                                • internals2.counter.function.counter-reset.html
                                • internals2.counter.html
                                • internals2.counter.ini.html
                                • internals2.counter.intro.html
                                • internals2.counter.resources.html
                                • internals2.counter.setup.html
                                • internals2.faq.html
                                • internals2.funcs.html
                                • internals2.html
                                • internals2.ini.html
                                • internals2.memory.html
                                • internals2.memory.management.html
                                • internals2.memory.persistence.html
                                • internals2.memory.tsrm.html
                                • internals2.opcodes.add-array-element.html
                                • internals2.opcodes.add-char.html
                                • internals2.opcodes.add-interface.html
                                • internals2.opcodes.add-string.html
                                • internals2.opcodes.add-var.html
                                • internals2.opcodes.add.html
                                • internals2.opcodes.assign-add.html
                                • internals2.opcodes.assign-bw-and.html
                                • internals2.opcodes.assign-bw-or.html
                                • internals2.opcodes.assign-bw-xor.html
                                • internals2.opcodes.assign-concat.html
                                • internals2.opcodes.assign-dim.html
                                • internals2.opcodes.assign-div.html
                                • internals2.opcodes.assign-mod.html
                                • internals2.opcodes.assign-mul.html
                                • internals2.opcodes.assign-obj.html
                                • internals2.opcodes.assign-ref.html
                                • internals2.opcodes.assign-sl.html
                                • internals2.opcodes.assign-sr.html
                                • internals2.opcodes.assign-sub.html
                                • internals2.opcodes.assign.html
                                • internals2.opcodes.begin-silence.html
                                • internals2.opcodes.bool-not.html
                                • internals2.opcodes.bool-xor.html
                                • internals2.opcodes.bool.html
                                • internals2.opcodes.brk.html
                                • internals2.opcodes.bw-and.html
                                • internals2.opcodes.bw-not.html
                                • internals2.opcodes.bw-or.html
                                • internals2.opcodes.bw-xor.html
                                • internals2.opcodes.case.html
                                • internals2.opcodes.cast.html
                                • internals2.opcodes.catch.html
                                • internals2.opcodes.clone.html
                                • internals2.opcodes.concat.html
                                • internals2.opcodes.cont.html
                                • internals2.opcodes.declare-class.html
                                • internals2.opcodes.declare-const.html
                                • internals2.opcodes.declare-function.html
                                • internals2.opcodes.declare-inherited-class-delayed.html
                                • internals2.opcodes.declare-inherited-class.html
                                • internals2.opcodes.div.html
                                • internals2.opcodes.do-fcall-by-name.html
                                • internals2.opcodes.do-fcall.html
                                • internals2.opcodes.echo.html
                                • internals2.opcodes.end-silence.html
                                • internals2.opcodes.exit.html
                                • internals2.opcodes.ext-fcall-begin.html
                                • internals2.opcodes.ext-fcall-end.html
                                • internals2.opcodes.ext-nop.html
                                • internals2.opcodes.ext-stmt.html
                                • internals2.opcodes.fe-fetch.html
                                • internals2.opcodes.fe-reset.html
                                • internals2.opcodes.fetch-class.html
                                • internals2.opcodes.fetch-constant.html
                                • internals2.opcodes.fetch-dim-func-arg.html
                                • internals2.opcodes.fetch-dim-is.html
                                • internals2.opcodes.fetch-dim-r.html
                                • internals2.opcodes.fetch-dim-rw.html
                                • internals2.opcodes.fetch-dim-tmp-var.html
                                • internals2.opcodes.fetch-dim-unset.html
                                • internals2.opcodes.fetch-dim-w.html
                                • internals2.opcodes.fetch-func-arg.html
                                • internals2.opcodes.fetch-is.html
                                • internals2.opcodes.fetch-obj-func-arg.html
                                • internals2.opcodes.fetch-obj-is.html
                                • internals2.opcodes.fetch-obj-r.html
                                • internals2.opcodes.fetch-obj-rw.html
                                • internals2.opcodes.fetch-obj-unset.html
                                • internals2.opcodes.fetch-obj-w.html
                                • internals2.opcodes.fetch-r.html
                                • internals2.opcodes.fetch-rw.html
                                • internals2.opcodes.fetch-unset.html
                                • internals2.opcodes.fetch-w.html
                                • internals2.opcodes.free.html
                                • internals2.opcodes.goto.html
                                • internals2.opcodes.handle-exception.html
                                • internals2.opcodes.html
                                • internals2.opcodes.include-or-eval.html
                                • internals2.opcodes.init-array.html
                                • internals2.opcodes.init-fcall-by-name.html
                                • internals2.opcodes.init-method-call.html
                                • internals2.opcodes.init-ns-fcall-by-name.html
                                • internals2.opcodes.init-static-method-call.html
                                • internals2.opcodes.init-string.html
                                • internals2.opcodes.instanceof.html
                                • internals2.opcodes.is-equal.html
                                • internals2.opcodes.is-identical.html
                                • internals2.opcodes.is-not-equal.html
                                • internals2.opcodes.is-not-identical.html
                                • internals2.opcodes.is-smaller-or-equal.html
                                • internals2.opcodes.is-smaller.html
                                • internals2.opcodes.isset-isempty-dim-obj.html
                                • internals2.opcodes.isset-isempty-prop-obj.html
                                • internals2.opcodes.isset-isempty-var.html
                                • internals2.opcodes.jmp.html
                                • internals2.opcodes.jmpnz-ex.html
                                • internals2.opcodes.jmpnz.html
                                • internals2.opcodes.jmpz-ex.html
                                • internals2.opcodes.jmpz.html
                                • internals2.opcodes.jmpznz.html
                                • internals2.opcodes.list.html
                                • internals2.opcodes.mod.html
                                • internals2.opcodes.mul.html
                                • internals2.opcodes.new.html
                                • internals2.opcodes.nop.html
                                • internals2.opcodes.post-dec-obj.html
                                • internals2.opcodes.post-dec.html
                                • internals2.opcodes.post-inc-obj.html
                                • internals2.opcodes.post-inc.html
                                • internals2.opcodes.pre-dec-obj.html
                                • internals2.opcodes.pre-dec.html
                                • internals2.opcodes.pre-inc-obj.html
                                • internals2.opcodes.pre-inc.html
                                • internals2.opcodes.print.html
                                • internals2.opcodes.qm-assign.html
                                • internals2.opcodes.raise-abstract-error.html
                                • internals2.opcodes.recv-init.html
                                • internals2.opcodes.recv.html
                                • internals2.opcodes.return-by-ref.html
                                • internals2.opcodes.return.html
                                • internals2.opcodes.send-ref.html
                                • internals2.opcodes.send-val.html
                                • internals2.opcodes.send-var-no-ref.html
                                • internals2.opcodes.send-var.html
                                • internals2.opcodes.sl.html
                                • internals2.opcodes.sr.html
                                • internals2.opcodes.sub.html
                                • internals2.opcodes.switch-free.html
                                • internals2.opcodes.throw.html
                                • internals2.opcodes.ticks.html
                                • internals2.opcodes.unset-dim.html
                                • internals2.opcodes.unset-obj.html
                                • internals2.opcodes.unset-var.html
                                • internals2.opcodes.user-opcode.html
                                • internals2.opcodes.verify-abstract-class.html
                                • internals2.opcodes.zend-declare-lambda-function.html
                                • internals2.opcodes.zend-jmp-set.html
                                • internals2.pdo.building.html
                                • internals2.pdo.constants.html
                                • internals2.pdo.error-handling.html
                                • internals2.pdo.html
                                • internals2.pdo.implementing.html
                                • internals2.pdo.packaging.html
                                • internals2.pdo.pdo-dbh-t.html
                                • internals2.pdo.pdo-stmt-t.html
                                • internals2.pdo.preparation.html
                                • internals2.pdo.prerequisites.html
                                • internals2.pdo.testing.html
                                • internals2.preface.html
                                • internals2.resources.html
                                • internals2.streams.html
                                • internals2.structure.basics.html
                                • internals2.structure.files.html
                                • internals2.structure.globals.html
                                • internals2.structure.html
                                • internals2.structure.lifecycle.html
                                • internals2.structure.modstruct.html
                                • internals2.structure.tests.html
                                • internals2.variables.arrays.html
                                • internals2.variables.html
                                • internals2.variables.intro.html
                                • internals2.variables.objects.html
                                • internals2.variables.tables.html
                                • internals2.ze1.html
                                • internals2.ze1.intro.html
                                • internals2.ze1.streams.html
                                • internals2.ze1.tsrm.html
                                • internals2.ze1.zendapi.html
                                • intl.configuration.html
                                • intl.constants.html
                                • intl.examples.basic.html
                                • intl.examples.html
                                • intl.installation.html
                                • intl.requirements.html
                                • intl.resources.html
                                • intl.setup.html
                                • intlbreakiterator.construct.html
                                • intlbreakiterator.createcharacterinstance.html
                                • intlbreakiterator.createcodepointinstance.html
                                • intlbreakiterator.createlineinstance.html
                                • intlbreakiterator.createsentenceinstance.html
                                • intlbreakiterator.createtitleinstance.html
                                • intlbreakiterator.createwordinstance.html
                                • intlbreakiterator.current.html
                                • intlbreakiterator.first.html
                                • intlbreakiterator.following.html
                                • intlbreakiterator.geterrorcode.html
                                • intlbreakiterator.geterrormessage.html
                                • intlbreakiterator.getlocale.html
                                • intlbreakiterator.getpartsiterator.html
                                • intlbreakiterator.gettext.html
                                • intlbreakiterator.isboundary.html
                                • intlbreakiterator.last.html
                                • intlbreakiterator.next.html
                                • intlbreakiterator.preceding.html
                                • intlbreakiterator.previous.html
                                • intlbreakiterator.settext.html
                                • intlcalendar.add.html
                                • intlcalendar.after.html
                                • intlcalendar.before.html
                                • intlcalendar.clear.html
                                • intlcalendar.construct.html
                                • intlcalendar.createinstance.html
                                • intlcalendar.equals.html
                                • intlcalendar.fielddifference.html
                                • intlcalendar.fromdatetime.html
                                • intlcalendar.get.html
                                • intlcalendar.getactualmaximum.html
                                • intlcalendar.getactualminimum.html
                                • intlcalendar.getavailablelocales.html
                                • intlcalendar.getdayofweektype.html
                                • intlcalendar.geterrorcode.html
                                • intlcalendar.geterrormessage.html
                                • intlcalendar.getfirstdayofweek.html
                                • intlcalendar.getgreatestminimum.html
                                • intlcalendar.getkeywordvaluesforlocale.html
                                • intlcalendar.getleastmaximum.html
                                • intlcalendar.getlocale.html
                                • intlcalendar.getmaximum.html
                                • intlcalendar.getminimaldaysinfirstweek.html
                                • intlcalendar.getminimum.html
                                • intlcalendar.getnow.html
                                • intlcalendar.getrepeatedwalltimeoption.html
                                • intlcalendar.getskippedwalltimeoption.html
                                • intlcalendar.gettime.html
                                • intlcalendar.gettimezone.html
                                • intlcalendar.gettype.html
                                • intlcalendar.getweekendtransition.html
                                • intlcalendar.indaylighttime.html
                                • intlcalendar.isequivalentto.html
                                • intlcalendar.islenient.html
                                • intlcalendar.isset.html
                                • intlcalendar.isweekend.html
                                • intlcalendar.roll.html
                                • intlcalendar.set.html
                                • intlcalendar.setfirstdayofweek.html
                                • intlcalendar.setlenient.html
                                • intlcalendar.setminimaldaysinfirstweek.html
                                • intlcalendar.setrepeatedwalltimeoption.html
                                • intlcalendar.setskippedwalltimeoption.html
                                • intlcalendar.settime.html
                                • intlcalendar.settimezone.html
                                • intlcalendar.todatetime.html
                                • intlchar.charage.html
                                • intlchar.chardigitvalue.html
                                • intlchar.chardirection.html
                                • intlchar.charfromname.html
                                • intlchar.charmirror.html
                                • intlchar.charname.html
                                • intlchar.chartype.html
                                • intlchar.chr.html
                                • intlchar.digit.html
                                • intlchar.enumcharnames.html
                                • intlchar.enumchartypes.html
                                • intlchar.foldcase.html
                                • intlchar.fordigit.html
                                • intlchar.getbidipairedbracket.html
                                • intlchar.getblockcode.html
                                • intlchar.getcombiningclass.html
                                • intlchar.getfc-nfkc-closure.html
                                • intlchar.getintpropertymaxvalue.html
                                • intlchar.getintpropertyminvalue.html
                                • intlchar.getintpropertyvalue.html
                                • intlchar.getnumericvalue.html
                                • intlchar.getpropertyenum.html
                                • intlchar.getpropertyname.html
                                • intlchar.getpropertyvalueenum.html
                                • intlchar.getpropertyvaluename.html
                                • intlchar.getunicodeversion.html
                                • intlchar.hasbinaryproperty.html
                                • intlchar.isalnum.html
                                • intlchar.isalpha.html
                                • intlchar.isbase.html
                                • intlchar.isblank.html
                                • intlchar.iscntrl.html
                                • intlchar.isdefined.html
                                • intlchar.isdigit.html
                                • intlchar.isgraph.html
                                • intlchar.isidignorable.html
                                • intlchar.isidpart.html
                                • intlchar.isidstart.html
                                • intlchar.isisocontrol.html
                                • intlchar.isjavaidpart.html
                                • intlchar.isjavaidstart.html
                                • intlchar.isjavaspacechar.html
                                • intlchar.islower.html
                                • intlchar.ismirrored.html
                                • intlchar.isprint.html
                                • intlchar.ispunct.html
                                • intlchar.isspace.html
                                • intlchar.istitle.html
                                • intlchar.isualphabetic.html
                                • intlchar.isulowercase.html
                                • intlchar.isupper.html
                                • intlchar.isuuppercase.html
                                • intlchar.isuwhitespace.html
                                • intlchar.iswhitespace.html
                                • intlchar.isxdigit.html
                                • intlchar.ord.html
                                • intlchar.tolower.html
                                • intlchar.totitle.html
                                • intlchar.toupper.html
                                • intlcodepointbreakiterator.getlastcodepoint.html
                                • intldateformatter.create.html
                                • intldateformatter.format.html
                                • intldateformatter.formatobject.html
                                • intldateformatter.getcalendar.html
                                • intldateformatter.getcalendarobject.html
                                • intldateformatter.getdatetype.html
                                • intldateformatter.geterrorcode.html
                                • intldateformatter.geterrormessage.html
                                • intldateformatter.getlocale.html
                                • intldateformatter.getpattern.html
                                • intldateformatter.gettimetype.html
                                • intldateformatter.gettimezone.html
                                • intldateformatter.gettimezoneid.html
                                • intldateformatter.islenient.html
                                • intldateformatter.localtime.html
                                • intldateformatter.parse.html
                                • intldateformatter.setcalendar.html
                                • intldateformatter.setlenient.html
                                • intldateformatter.setpattern.html
                                • intldateformatter.settimezone.html
                                • intldateformatter.settimezoneid.html
                                • intliterator.current.html
                                • intliterator.key.html
                                • intliterator.next.html
                                • intliterator.rewind.html
                                • intliterator.valid.html
                                • intlpartsiterator.getbreakiterator.html
                                • intlrulebasedbreakiterator.construct.html
                                • intlrulebasedbreakiterator.getbinaryrules.html
                                • intlrulebasedbreakiterator.getrules.html
                                • intlrulebasedbreakiterator.getrulestatus.html
                                • intlrulebasedbreakiterator.getrulestatusvec.html
                                • intltimezone.countequivalentids.html
                                • intltimezone.createdefault.html
                                • intltimezone.createenumeration.html
                                • intltimezone.createtimezone.html
                                • intltimezone.fromdatetimezone.html
                                • intltimezone.getcanonicalid.html
                                • intltimezone.getdisplayname.html
                                • intltimezone.getdstsavings.html
                                • intltimezone.getequivalentid.html
                                • intltimezone.geterrorcode.html
                                • intltimezone.geterrormessage.html
                                • intltimezone.getgmt.html
                                • intltimezone.getid.html
                                • intltimezone.getoffset.html
                                • intltimezone.getrawoffset.html
                                • intltimezone.gettzdataversion.html
                                • intltimezone.hassamerules.html
                                • intltimezone.todatetimezone.html
                                • intltimezone.usedaylighttime.html
                                • intro-whatcando.html
                                • intro-whatis.html
                                • intro.apache.html
                                • intro.apc.html
                                • intro.apcu.html
                                • intro.apd.html
                                • intro.array.html
                                • intro.bbcode.html
                                • intro.bc.html
                                • intro.bcompiler.html
                                • intro.blenc.html
                                • intro.bzip2.html
                                • intro.cairo.html
                                • intro.calendar.html
                                • intro.chdb.html
                                • intro.classkit.html
                                • intro.classobj.html
                                • intro.com.html
                                • intro.crack.html
                                • intro.csprng.html
                                • intro.ctype.html
                                • intro.cubrid.html
                                • intro.curl.html
                                • intro.cyrus.html
                                • intro.datetime.html
                                • intro.dba.html
                                • intro.dbase.html
                                • intro.dbplus.html
                                • intro.dbx.html
                                • intro.dio.html
                                • intro.dom.html
                                • intro.eio.html
                                • intro.enchant.html
                                • intro.errorfunc.html
                                • intro.ev.html
                                • intro.event.html
                                • intro.exec.html
                                • intro.exif.html
                                • intro.expect.html
                                • intro.fam.html
                                • intro.fann.html
                                • intro.fbsql.html
                                • intro.fdf.html
                                • intro.fileinfo.html
                                • intro.filepro.html
                                • intro.filesystem.html
                                • intro.filter.html
                                • intro.fpm.html
                                • intro.fribidi.html
                                • intro.ftp.html
                                • intro.funchand.html
                                • intro.gearman.html
                                • intro.gender.html
                                • intro.geoip.html
                                • intro.gettext.html
                                • intro.gmagick.html
                                • intro.gmp.html
                                • intro.gnupg.html
                                • intro.gupnp.html
                                • intro.haru.html
                                • intro.hash.html
                                • intro.hrtime.html
                                • intro.htscanner.html
                                • intro.http.html
                                • intro.hwapi.html
                                • intro.ibase.html
                                • intro.ibm-db2.html
                                • intro.iconv.html
                                • intro.id3.html
                                • intro.ifx.html
                                • intro.iisfunc.html
                                • intro.image.html
                                • intro.imagick.html
                                • intro.imap.html
                                • intro.inclued.html
                                • intro.info.html
                                • intro.ingres.html
                                • intro.inotify.html
                                • intro.intl.html
                                • intro.json.html
                                • intro.judy.html
                                • intro.kadm5.html
                                • intro.ktaglib.html
                                • intro.lapack.html
                                • intro.ldap.html
                                • intro.libevent.html
                                • intro.libxml.html
                                • intro.lua.html
                                • intro.lzf.html
                                • intro.mail.html
                                • intro.mailparse.html
                                • intro.math.html
                                • intro.maxdb.html
                                • intro.mbstring.html
                                • intro.mcrypt.html
                                • intro.mcve.html
                                • intro.memcache.html
                                • intro.memcached.html
                                • intro.memtrack.html
                                • intro.mhash.html
                                • intro.mime-magic.html
                                • intro.ming.html
                                • intro.misc.html
                                • intro.mnogosearch.html
                                • intro.mqseries.html
                                • intro.msession.html
                                • intro.msql.html
                                • intro.mssql.html
                                • intro.mysql.html
                                • intro.mysqli.html
                                • intro.mysqlnd-memcache.html
                                • intro.mysqlnd-ms.html
                                • intro.mysqlnd-mux.html
                                • intro.mysqlnd-qc.html
                                • intro.mysqlnd-uh.html
                                • intro.mysqlnd.html
                                • intro.ncurses.html
                                • intro.net-gopher.html
                                • intro.network.html
                                • intro.newt.html
                                • intro.nis.html
                                • intro.nsapi.html
                                • intro.oauth.html
                                • intro.oci8.html
                                • intro.oggvorbis.html
                                • intro.opcache.html
                                • intro.openal.html
                                • intro.openssl.html
                                • intro.outcontrol.html
                                • intro.paradox.html
                                • intro.parsekit.html
                                • intro.password.html
                                • intro.pcntl.html
                                • intro.pcre.html
                                • intro.pdf.html
                                • intro.pdo.html
                                • intro.pgsql.html
                                • intro.phar.html
                                • intro.posix.html
                                • intro.proctitle.html
                                • intro.ps.html
                                • intro.pspell.html
                                • intro.pthreads.html
                                • intro.quickhash.html
                                • intro.radius.html
                                • intro.rar.html
                                • intro.readline.html
                                • intro.recode.html
                                • intro.reflection.html
                                • intro.regex.html
                                • intro.rpmreader.html
                                • intro.rrd.html
                                • intro.runkit.html
                                • intro.sam.html
                                • intro.sca.html
                                • intro.scream.html
                                • intro.sdo-das-xml.html
                                • intro.sdo.html
                                • intro.sdodasrel.html
                                • intro.sem.html
                                • intro.session-pgsql.html
                                • intro.session.html
                                • intro.shmop.html
                                • intro.simplexml.html
                                • intro.snmp.html
                                • intro.soap.html
                                • intro.sockets.html
                                • intro.solr.html
                                • intro.sphinx.html
                                • intro.spl-types.html
                                • intro.spl.html
                                • intro.spplus.html
                                • intro.sqlite.html
                                • intro.sqlite3.html
                                • intro.sqlsrv.html
                                • intro.ssdeep.html
                                • intro.ssh2.html
                                • intro.stats.html
                                • intro.stomp.html
                                • intro.stream.html
                                • intro.strings.html
                                • intro.svm.html
                                • intro.svn.html
                                • intro.swish.html
                                • intro.sybase.html
                                • intro.sync.html
                                • intro.taint.html
                                • intro.tcpwrap.html
                                • intro.tidy.html
                                • intro.tokenizer.html
                                • intro.tokyo-tyrant.html
                                • intro.trader.html
                                • intro.uodbc.html
                                • intro.uopz.html
                                • intro.url.html
                                • intro.v8js.html
                                • intro.var.html
                                • intro.varnish.html
                                • intro.vpopmail.html
                                • intro.wddx.html
                                • intro.weakref.html
                                • intro.win32ps.html
                                • intro.win32service.html
                                • intro.wincache.html
                                • intro.xattr.html
                                • intro.xdiff.html
                                • intro.xhprof.html
                                • intro.xml.html
                                • intro.xmldiff.html
                                • intro.xmlreader.html
                                • intro.xmlrpc.html
                                • intro.xmlwriter.html
                                • intro.xsl.html
                                • intro.yaf.html
                                • intro.yaml.html
                                • intro.yar.html
                                • intro.yaz.html
                                • intro.zip.html
                                • intro.zlib.html
                                • intro.zmq.html
                                • introduction.html
                                • iterator.current.html
                                • iterator.key.html
                                • iterator.next.html
                                • iterator.rewind.html
                                • iterator.valid.html
                                • iteratoraggregate.getiterator.html
                                • iteratoriterator.construct.html
                                • iteratoriterator.current.html
                                • iteratoriterator.getinneriterator.html
                                • iteratoriterator.key.html
                                • iteratoriterator.next.html
                                • iteratoriterator.rewind.html
                                • iteratoriterator.valid.html
                                • json.configuration.html
                                • json.constants.html
                                • json.installation.html
                                • json.requirements.html
                                • json.resources.html
                                • json.setup.html
                                • jsonserializable.jsonserialize.html
                                • judy.bycount.html
                                • judy.configuration.html
                                • judy.construct.html
                                • judy.count.html
                                • judy.destruct.html
                                • judy.first.html
                                • judy.firstempty.html
                                • judy.free.html
                                • judy.gettype.html
                                • judy.installation.html
                                • judy.last.html
                                • judy.lastempty.html
                                • judy.memoryusage.html
                                • judy.next.html
                                • judy.nextempty.html
                                • judy.offsetexists.html
                                • judy.offsetget.html
                                • judy.offsetset.html
                                • judy.offsetunset.html
                                • judy.prev.html
                                • judy.prevempty.html
                                • judy.requirements.html
                                • judy.resources.html
                                • judy.setup.html
                                • judy.size.html
                                • kadm5.configuration.html
                                • kadm5.constants.html
                                • kadm5.constantsaf.html
                                • kadm5.examples-connect.html
                                • kadm5.examples.html
                                • kadm5.installation.html
                                • kadm5.requirements.html
                                • kadm5.resources.html
                                • kadm5.setup.html
                                • keyword.class.html
                                • keyword.extends.html
                                • keyword.paamayim-nekudotayim.html
                                • keyword.parent.html
                                • ktaglib.constants.html
                                • ktaglib.installation.html
                                • ktaglib.requirements.html
                                • ktaglib.setup.html
                                • langref.html
                                • language.basic-syntax.comments.html
                                • language.basic-syntax.html
                                • language.basic-syntax.instruction-separation.html
                                • language.basic-syntax.phpmode.html
                                • language.basic-syntax.phptags.html
                                • language.constants.html
                                • language.constants.predefined.html
                                • language.constants.syntax.html
                                • language.control-structures.html
                                • language.errors.basics.html
                                • language.errors.html
                                • language.errors.php7.html
                                • language.exceptions.extending.html
                                • language.exceptions.html
                                • language.expressions.html
                                • language.functions.html
                                • language.generators.comparison.html
                                • language.generators.html
                                • language.generators.overview.html
                                • language.generators.syntax.html
                                • language.namespaces.basics.html
                                • language.namespaces.definition.html
                                • language.namespaces.definitionmultiple.html
                                • language.namespaces.dynamic.html
                                • language.namespaces.fallback.html
                                • language.namespaces.faq.html
                                • language.namespaces.global.html
                                • language.namespaces.html
                                • language.namespaces.importing.html
                                • language.namespaces.nested.html
                                • language.namespaces.nsconstants.html
                                • language.namespaces.rationale.html
                                • language.namespaces.rules.html
                                • language.oop5.abstract.html
                                • language.oop5.anonymous.html
                                • language.oop5.autoload.html
                                • language.oop5.basic.html
                                • language.oop5.changelog.html
                                • language.oop5.cloning.html
                                • language.oop5.constants.html
                                • language.oop5.decon.html
                                • language.oop5.final.html
                                • language.oop5.html
                                • language.oop5.inheritance.html
                                • language.oop5.interfaces.html
                                • language.oop5.iterations.html
                                • language.oop5.late-static-bindings.html
                                • language.oop5.magic.html
                                • language.oop5.object-comparison.html
                                • language.oop5.overloading.html
                                • language.oop5.paamayim-nekudotayim.html
                                • language.oop5.properties.html
                                • language.oop5.references.html
                                • language.oop5.serialization.html
                                • language.oop5.static.html
                                • language.oop5.traits.html
                                • language.oop5.typehinting.html
                                • language.oop5.visibility.html
                                • language.operators.arithmetic.html
                                • language.operators.array.html
                                • language.operators.assignment.html
                                • language.operators.bitwise.html
                                • language.operators.comparison.html
                                • language.operators.errorcontrol.html
                                • language.operators.execution.html
                                • language.operators.html
                                • language.operators.increment.html
                                • language.operators.logical.html
                                • language.operators.precedence.html
                                • language.operators.string.html
                                • language.operators.type.html
                                • language.pseudo-types.html
                                • language.references.arent.html
                                • language.references.html
                                • language.references.pass.html
                                • language.references.return.html
                                • language.references.spot.html
                                • language.references.unset.html
                                • language.references.whatare.html
                                • language.references.whatdo.html
                                • language.types.array.html
                                • language.types.boolean.html
                                • language.types.callable.html
                                • language.types.float.html
                                • language.types.html
                                • language.types.integer.html
                                • language.types.intro.html
                                • language.types.null.html
                                • language.types.object.html
                                • language.types.resource.html
                                • language.types.string.html
                                • language.types.type-juggling.html
                                • language.variables.basics.html
                                • language.variables.external.html
                                • language.variables.html
                                • language.variables.predefined.html
                                • language.variables.scope.html
                                • language.variables.superglobals.html
                                • language.variables.variable.html
                                • lapack.configuration.html
                                • lapack.constants.html
                                • lapack.eigenvalues.html
                                • lapack.identity.html
                                • lapack.installation.html
                                • lapack.leastsquaresbyfactorisation.html
                                • lapack.leastsquaresbysvd.html
                                • lapack.pseudoinverse.html
                                • lapack.requirements.html
                                • lapack.resources.html
                                • lapack.setup.html
                                • lapack.singularvalues.html
                                • lapack.solvelinearequation.html
                                • ldap.configuration.html
                                • ldap.constants.html
                                • ldap.examples-basic.html
                                • ldap.examples.html
                                • ldap.installation.html
                                • ldap.requirements.html
                                • ldap.resources.html
                                • ldap.setup.html
                                • ldap.using.html
                                • libevent.configuration.html
                                • libevent.constants.html
                                • libevent.examples.html
                                • libevent.installation.html
                                • libevent.requirements.html
                                • libevent.resources.html
                                • libevent.setup.html
                                • libxml.configuration.html
                                • libxml.constants.html
                                • libxml.installation.html
                                • libxml.requirements.html
                                • libxml.resources.html
                                • libxml.setup.html
                                • limititerator.construct.html
                                • limititerator.current.html
                                • limititerator.getinneriterator.html
                                • limititerator.getposition.html
                                • limititerator.key.html
                                • limititerator.next.html
                                • limititerator.rewind.html
                                • limititerator.seek.html
                                • limititerator.valid.html
                                • locale.acceptfromhttp.html
                                • locale.canonicalize.html
                                • locale.composelocale.html
                                • locale.filtermatches.html
                                • locale.getallvariants.html
                                • locale.getdefault.html
                                • locale.getdisplaylanguage.html
                                • locale.getdisplayname.html
                                • locale.getdisplayregion.html
                                • locale.getdisplayscript.html
                                • locale.getdisplayvariant.html
                                • locale.getkeywords.html
                                • locale.getprimarylanguage.html
                                • locale.getregion.html
                                • locale.getscript.html
                                • locale.lookup.html
                                • locale.parselocale.html
                                • locale.setdefault.html
                                • lua.assign.html
                                • lua.call.html
                                • lua.configuration.html
                                • lua.construct.html
                                • lua.eval.html
                                • lua.getversion.html
                                • lua.include.html
                                • lua.installation.html
                                • lua.registercallback.html
                                • lua.requirements.html
                                • lua.resources.html
                                • lua.setup.html
                                • luaclosure.invoke.html
                                • lzf.configuration.html
                                • lzf.constants.html
                                • lzf.installation.html
                                • lzf.requirements.html
                                • lzf.resources.html
                                • lzf.setup.html
                                • mail.configuration.html
                                • mail.constants.html
                                • mail.installation.html
                                • mail.requirements.html
                                • mail.resources.html
                                • mail.setup.html
                                • mailparse.configuration.html
                                • mailparse.constants.html
                                • mailparse.installation.html
                                • mailparse.requirements.html
                                • mailparse.resources.html
                                • mailparse.setup.html
                                • manual.html
                                • math.configuration.html
                                • math.constants.html
                                • math.installation.html
                                • math.requirements.html
                                • math.resources.html
                                • math.setup.html
                                • maxdb.configuration.html
                                • maxdb.constants.html
                                • maxdb.examples-basic.html
                                • maxdb.examples.html
                                • maxdb.installation.html
                                • maxdb.requirements.html
                                • maxdb.resources.html
                                • maxdb.setup.html
                                • mbstring.configuration.html
                                • mbstring.constants.html
                                • mbstring.encodings.html
                                • mbstring.http.html
                                • mbstring.installation.html
                                • mbstring.ja-basic.html
                                • mbstring.overload.html
                                • mbstring.php4.req.html
                                • mbstring.requirements.html
                                • mbstring.resources.html
                                • mbstring.setup.html
                                • mbstring.supported-encodings.html
                                • mcrypt.ciphers.html
                                • mcrypt.configuration.html
                                • mcrypt.constants.html
                                • mcrypt.examples.html
                                • mcrypt.installation.html
                                • mcrypt.requirements.html
                                • mcrypt.resources.html
                                • mcrypt.setup.html
                                • mcve.configuration.html
                                • mcve.constants.html
                                • mcve.installation.html
                                • mcve.requirements.html
                                • mcve.resources.html
                                • mcve.setup.html
                                • memcache.add.html
                                • memcache.addserver.html
                                • memcache.close.html
                                • memcache.connect.html
                                • memcache.constants.html
                                • memcache.decrement.html
                                • memcache.delete.html
                                • memcache.examples-overview.html
                                • memcache.examples.html
                                • memcache.flush.html
                                • memcache.get.html
                                • memcache.getextendedstats.html
                                • memcache.getserverstatus.html
                                • memcache.getstats.html
                                • memcache.getversion.html
                                • memcache.increment.html
                                • memcache.ini.html
                                • memcache.installation.html
                                • memcache.pconnect.html
                                • memcache.replace.html
                                • memcache.requirements.html
                                • memcache.resources.html
                                • memcache.set.html
                                • memcache.setcompressthreshold.html
                                • memcache.setserverparams.html
                                • memcache.setup.html
                                • memcached.add.html
                                • memcached.addbykey.html
                                • memcached.addserver.html
                                • memcached.addservers.html
                                • memcached.append.html
                                • memcached.appendbykey.html
                                • memcached.callbacks.html
                                • memcached.callbacks.read-through.html
                                • memcached.callbacks.result.html
                                • memcached.cas.html
                                • memcached.casbykey.html
                                • memcached.configuration.html
                                • memcached.constants.html
                                • memcached.construct.html
                                • memcached.decrement.html
                                • memcached.decrementbykey.html
                                • memcached.delete.html
                                • memcached.deletebykey.html
                                • memcached.deletemulti.html
                                • memcached.deletemultibykey.html
                                • memcached.expiration.html
                                • memcached.fetch.html
                                • memcached.fetchall.html
                                • memcached.flush.html
                                • memcached.get.html
                                • memcached.getallkeys.html
                                • memcached.getbykey.html
                                • memcached.getdelayed.html
                                • memcached.getdelayedbykey.html
                                • memcached.getmulti.html
                                • memcached.getmultibykey.html
                                • memcached.getoption.html
                                • memcached.getresultcode.html
                                • memcached.getresultmessage.html
                                • memcached.getserverbykey.html
                                • memcached.getserverlist.html
                                • memcached.getstats.html
                                • memcached.getversion.html
                                • memcached.increment.html
                                • memcached.incrementbykey.html
                                • memcached.installation.html
                                • memcached.ispersistent.html
                                • memcached.ispristine.html
                                • memcached.prepend.html
                                • memcached.prependbykey.html
                                • memcached.quit.html
                                • memcached.replace.html
                                • memcached.replacebykey.html
                                • memcached.requirements.html
                                • memcached.resetserverlist.html
                                • memcached.resources.html
                                • memcached.sessions.html
                                • memcached.set.html
                                • memcached.setbykey.html
                                • memcached.setmulti.html
                                • memcached.setmultibykey.html
                                • memcached.setoption.html
                                • memcached.setoptions.html
                                • memcached.setsaslauthdata.html
                                • memcached.setup.html
                                • memcached.touch.html
                                • memcached.touchbykey.html
                                • memtrack.constants.html
                                • memtrack.examples.basic.html
                                • memtrack.examples.html
                                • memtrack.ini.html
                                • memtrack.installation.html
                                • memtrack.requirements.html
                                • memtrack.resources.html
                                • memtrack.setup.html
                                • messageformatter.create.html
                                • messageformatter.format.html
                                • messageformatter.formatmessage.html
                                • messageformatter.geterrorcode.html
                                • messageformatter.geterrormessage.html
                                • messageformatter.getlocale.html
                                • messageformatter.getpattern.html
                                • messageformatter.parse.html
                                • messageformatter.parsemessage.html
                                • messageformatter.setpattern.html
                                • mhash.configuration.html
                                • mhash.constants.html
                                • mhash.examples.html
                                • mhash.installation.html
                                • mhash.requirements.html
                                • mhash.resources.html
                                • mhash.setup.html
                                • migrating5.errorrep.html
                                • migration5.changes.html
                                • migration5.cli-cgi.html
                                • migration5.configuration.html
                                • migration5.databases.html
                                • migration5.functions.html
                                • migration5.html
                                • migration5.incompatible.html
                                • migration5.newconf.html
                                • migration5.oop.html
                                • migration51.changes.html
                                • migration51.databases.html
                                • migration51.datetime.html
                                • migration51.errorcheck.html
                                • migration51.extensions.html
                                • migration51.html
                                • migration51.integer-parameters.html
                                • migration51.oop.html
                                • migration51.reading.html
                                • migration51.references.html
                                • migration52.changes.html
                                • migration52.class-constants.html
                                • migration52.classes.html
                                • migration52.datetime.html
                                • migration52.error-messages.html
                                • migration52.errorrep.html
                                • migration52.functions.html
                                • migration52.global-constants.html
                                • migration52.html
                                • migration52.incompatible.html
                                • migration52.methods.html
                                • migration52.new-extensions.html
                                • migration52.newconf.html
                                • migration52.other.html
                                • migration52.parameters.html
                                • migration52.removed-extensions.html
                                • migration53.changes.html
                                • migration53.class-constants.html
                                • migration53.classes.html
                                • migration53.deprecated.html
                                • migration53.extensions-other.html
                                • migration53.functions.html
                                • migration53.global-constants.html
                                • migration53.html
                                • migration53.incompatible.html
                                • migration53.ini.html
                                • migration53.methods.html
                                • migration53.new-extensions.html
                                • migration53.new-features.html
                                • migration53.new-stream-filters.html
                                • migration53.new-stream-wrappers.html
                                • migration53.other.html
                                • migration53.parameters.html
                                • migration53.removed-extensions.html
                                • migration53.sapi.html
                                • migration53.undeprecated.html
                                • migration53.windows.html
                                • migration54.changes.html
                                • migration54.classes.html
                                • migration54.deprecated.html
                                • migration54.extensions-other.html
                                • migration54.functions.html
                                • migration54.global-constants.html
                                • migration54.html
                                • migration54.incompatible.html
                                • migration54.ini.html
                                • migration54.methods.html
                                • migration54.new-features.html
                                • migration54.other.html
                                • migration54.parameters.html
                                • migration54.removed-extensions.html
                                • migration54.sapi.html
                                • migration55.changed-functions.html
                                • migration55.changes.html
                                • migration55.classes.html
                                • migration55.deprecated.html
                                • migration55.extensions-other.html
                                • migration55.global-constants.html
                                • migration55.html
                                • migration55.incompatible.html
                                • migration55.ini.html
                                • migration55.internals.html
                                • migration55.new-features.html
                                • migration55.new-functions.html
                                • migration55.new-methods.html
                                • migration56.changed-functions.html
                                • migration56.constants.html
                                • migration56.deprecated.html
                                • migration56.extensions.html
                                • migration56.html
                                • migration56.incompatible.html
                                • migration56.new-features.html
                                • migration56.new-functions.html
                                • migration56.openssl.html
                                • migration70.changed-functions.html
                                • migration70.classes.html
                                • migration70.constants.html
                                • migration70.deprecated.html
                                • migration70.html
                                • migration70.incompatible.html
                                • migration70.new-features.html
                                • migration70.new-functions.html
                                • migration70.other-changes.html
                                • migration70.removed-exts-sapis.html
                                • migration70.sapi-changes.html
                                • mime-magic.configuration.html
                                • mime-magic.constants.html
                                • mime-magic.installation.html
                                • mime-magic.requirements.html
                                • mime-magic.resources.html
                                • mime-magic.setup.html
                                • ming.configuration.html
                                • ming.constants.html
                                • ming.examples.html
                                • ming.examples.swfaction.html
                                • ming.examples.swfsprite-basic.html
                                • ming.install.html
                                • ming.requirements.html
                                • ming.resources.html
                                • ming.setup.html
                                • misc.configuration.html
                                • misc.constants.html
                                • misc.installation.html
                                • misc.requirements.html
                                • misc.resources.html
                                • misc.setup.html
                                • mnogosearch.configuration.html
                                • mnogosearch.constants.html
                                • mnogosearch.installation.html
                                • mnogosearch.requirements.html
                                • mnogosearch.resources.html
                                • mnogosearch.setup.html
                                • mongo.batch.html
                                • mongo.configuration.html
                                • mongo.connecting.auth.html
                                • mongo.connecting.html
                                • mongo.connecting.mongos.html
                                • mongo.connecting.persistent.html
                                • mongo.connecting.persistent.manual.html
                                • mongo.connecting.pools.html
                                • mongo.connecting.rs.html
                                • mongo.connecting.ssl.html
                                • mongo.connecting.uds.html
                                • mongo.connectutil.html
                                • mongo.constants.html
                                • mongo.construct.html
                                • mongo.context.html
                                • mongo.core.html
                                • mongo.exceptions.html
                                • mongo.getpoolsize.html
                                • mongo.getslave.html
                                • mongo.getslaveokay.html
                                • mongo.gridfs.html
                                • mongo.installation.html
                                • mongo.manual.html
                                • mongo.miscellaneous.html
                                • mongo.pooldebug.html
                                • mongo.queries.html
                                • mongo.readpreferences.html
                                • mongo.requirements.html
                                • mongo.security.html
                                • mongo.setpoolsize.html
                                • mongo.setslaveokay.html
                                • mongo.setup.html
                                • mongo.sqltomongo.html
                                • mongo.switchslave.html
                                • mongo.testing.html
                                • mongo.trouble.html
                                • mongo.tutorial.collection.html
                                • mongo.tutorial.connecting.html
                                • mongo.tutorial.counting.html
                                • mongo.tutorial.criteria.html
                                • mongo.tutorial.cursor.html
                                • mongo.tutorial.findone.html
                                • mongo.tutorial.html
                                • mongo.tutorial.indexes.html
                                • mongo.tutorial.insert.html
                                • mongo.tutorial.insert.multiple.html
                                • mongo.tutorial.multi.query.html
                                • mongo.tutorial.selectdb.html
                                • mongo.types.html
                                • mongo.updates.html
                                • mongo.writeconcerns.html
                                • mongo.writes.html
                                • mongobindata.construct.html
                                • mongobindata.tostring.html
                                • mongoclient.close.html
                                • mongoclient.connect.html
                                • mongoclient.construct.html
                                • mongoclient.dropdb.html
                                • mongoclient.get.html
                                • mongoclient.getconnections.html
                                • mongoclient.gethosts.html
                                • mongoclient.getreadpreference.html
                                • mongoclient.getwriteconcern.html
                                • mongoclient.killcursor.html
                                • mongoclient.listdbs.html
                                • mongoclient.selectcollection.html
                                • mongoclient.selectdb.html
                                • mongoclient.setreadpreference.html
                                • mongoclient.setwriteconcern.html
                                • mongoclient.tostring.html
                                • mongocode.construct.html
                                • mongocode.tostring.html
                                • mongocollection.--tostring.html
                                • mongocollection.aggregate.html
                                • mongocollection.aggregatecursor.html
                                • mongocollection.batchinsert.html
                                • mongocollection.construct.html
                                • mongocollection.count.html
                                • mongocollection.createdbref.html
                                • mongocollection.createindex.html
                                • mongocollection.deleteindex.html
                                • mongocollection.deleteindexes.html
                                • mongocollection.distinct.html
                                • mongocollection.drop.html
                                • mongocollection.ensureindex.html
                                • mongocollection.find.html
                                • mongocollection.findandmodify.html
                                • mongocollection.findone.html
                                • mongocollection.get.html
                                • mongocollection.getdbref.html
                                • mongocollection.getindexinfo.html
                                • mongocollection.getname.html
                                • mongocollection.getreadpreference.html
                                • mongocollection.getslaveokay.html
                                • mongocollection.getwriteconcern.html
                                • mongocollection.group.html
                                • mongocollection.insert.html
                                • mongocollection.parallelcollectionscan.html
                                • mongocollection.remove.html
                                • mongocollection.save.html
                                • mongocollection.setreadpreference.html
                                • mongocollection.setslaveokay.html
                                • mongocollection.setwriteconcern.html
                                • mongocollection.toindexstring.html
                                • mongocollection.update.html
                                • mongocollection.validate.html
                                • mongocommandcursor.batchsize.html
                                • mongocommandcursor.construct.html
                                • mongocommandcursor.createfromdocument.html
                                • mongocommandcursor.current.html
                                • mongocommandcursor.dead.html
                                • mongocommandcursor.getreadpreference.html
                                • mongocommandcursor.info.html
                                • mongocommandcursor.key.html
                                • mongocommandcursor.next.html
                                • mongocommandcursor.rewind.html
                                • mongocommandcursor.setreadpreference.html
                                • mongocommandcursor.timeout.html
                                • mongocommandcursor.valid.html
                                • mongocursor.addoption.html
                                • mongocursor.awaitdata.html
                                • mongocursor.batchsize.html
                                • mongocursor.construct.html
                                • mongocursor.count.html
                                • mongocursor.current.html
                                • mongocursor.dead.html
                                • mongocursor.doquery.html
                                • mongocursor.explain.html
                                • mongocursor.fields.html
                                • mongocursor.getnext.html
                                • mongocursor.getreadpreference.html
                                • mongocursor.hasnext.html
                                • mongocursor.hint.html
                                • mongocursor.immortal.html
                                • mongocursor.info.html
                                • mongocursor.key.html
                                • mongocursor.limit.html
                                • mongocursor.maxtimems.html
                                • mongocursor.next.html
                                • mongocursor.partial.html
                                • mongocursor.reset.html
                                • mongocursor.rewind.html
                                • mongocursor.setflag.html
                                • mongocursor.setreadpreference.html
                                • mongocursor.skip.html
                                • mongocursor.slaveokay.html
                                • mongocursor.snapshot.html
                                • mongocursor.sort.html
                                • mongocursor.tailable.html
                                • mongocursor.timeout.html
                                • mongocursor.valid.html
                                • mongocursorexception.gethost.html
                                • mongocursorinterface.batchsize.html
                                • mongocursorinterface.dead.html
                                • mongocursorinterface.getreadpreference.html
                                • mongocursorinterface.info.html
                                • mongocursorinterface.setreadpreference.html
                                • mongocursorinterface.timeout.html
                                • mongodate.construct.html
                                • mongodate.todatetime.html
                                • mongodate.tostring.html
                                • mongodb-bson-binary.construct.html
                                • mongodb-bson-binary.getdata.html
                                • mongodb-bson-binary.gettype.html
                                • mongodb-bson-javascript.construct.html
                                • mongodb-bson-maxkey.construct.html
                                • mongodb-bson-minkey.construct.html
                                • mongodb-bson-objectid.construct.html
                                • mongodb-bson-objectid.tostring.html
                                • mongodb-bson-regex.construct.html
                                • mongodb-bson-regex.getflags.html
                                • mongodb-bson-regex.getpattern.html
                                • mongodb-bson-regex.tostring.html
                                • mongodb-bson-serializable.bsonserialize.html
                                • mongodb-bson-timestamp.construct.html
                                • mongodb-bson-timestamp.tostring.html
                                • mongodb-bson-unserializable.bsonunserialize.html
                                • mongodb-bson-utcdatetime.construct.html
                                • mongodb-bson-utcdatetime.todatetime.html
                                • mongodb-bson-utcdatetime.tostring.html
                                • mongodb-driver-bulkwrite.construct.html
                                • mongodb-driver-bulkwrite.count.html
                                • mongodb-driver-bulkwrite.delete.html
                                • mongodb-driver-bulkwrite.insert.html
                                • mongodb-driver-bulkwrite.update.html
                                • mongodb-driver-command.construct.html
                                • mongodb-driver-cursor.construct.html
                                • mongodb-driver-cursor.getid.html
                                • mongodb-driver-cursor.getserver.html
                                • mongodb-driver-cursor.isdead.html
                                • mongodb-driver-cursor.settypemap.html
                                • mongodb-driver-cursor.toarray.html
                                • mongodb-driver-cursorid.construct.html
                                • mongodb-driver-cursorid.tostring.html
                                • mongodb-driver-manager.construct.html
                                • mongodb-driver-manager.executebulkwrite.html
                                • mongodb-driver-manager.executecommand.html
                                • mongodb-driver-manager.executequery.html
                                • mongodb-driver-manager.getservers.html
                                • mongodb-driver-manager.selectserver.html
                                • mongodb-driver-query.construct.html
                                • mongodb-driver-readconcern.construct.html
                                • mongodb-driver-readconcern.getlevel.html
                                • mongodb-driver-readpreference.construct.html
                                • mongodb-driver-readpreference.getmode.html
                                • mongodb-driver-readpreference.gettagsets.html
                                • mongodb-driver-server.construct.html
                                • mongodb-driver-server.executebulkwrite.html
                                • mongodb-driver-server.executecommand.html
                                • mongodb-driver-server.executequery.html
                                • mongodb-driver-server.gethost.html
                                • mongodb-driver-server.getinfo.html
                                • mongodb-driver-server.getlatency.html
                                • mongodb-driver-server.getport.html
                                • mongodb-driver-server.gettags.html
                                • mongodb-driver-server.gettype.html
                                • mongodb-driver-server.isarbiter.html
                                • mongodb-driver-server.ishidden.html
                                • mongodb-driver-server.ispassive.html
                                • mongodb-driver-server.isprimary.html
                                • mongodb-driver-server.issecondary.html
                                • mongodb-driver-writeconcern.construct.html
                                • mongodb-driver-writeconcern.getjournal.html
                                • mongodb-driver-writeconcern.getw.html
                                • mongodb-driver-writeconcern.getwtimeout.html
                                • mongodb-driver-writeconcernerror.getcode.html
                                • mongodb-driver-writeconcernerror.getinfo.html
                                • mongodb-driver-writeconcernerror.getmessage.html
                                • mongodb-driver-writeerror.getcode.html
                                • mongodb-driver-writeerror.getindex.html
                                • mongodb-driver-writeerror.getmessage.html
                                • mongodb-driver-writeexception.getwriteresult.html
                                • mongodb-driver-writeresult.getdeletedcount.html
                                • mongodb-driver-writeresult.getinfo.html
                                • mongodb-driver-writeresult.getinsertedcount.html
                                • mongodb-driver-writeresult.getmatchedcount.html
                                • mongodb-driver-writeresult.getmodifiedcount.html
                                • mongodb-driver-writeresult.getserver.html
                                • mongodb-driver-writeresult.getupsertedcount.html
                                • mongodb-driver-writeresult.getupsertedids.html
                                • mongodb-driver-writeresult.getwriteconcernerror.html
                                • mongodb-driver-writeresult.getwriteerrors.html
                                • mongodb.--tostring.html
                                • mongodb.architecture.html
                                • mongodb.authenticate.html
                                • mongodb.command.html
                                • mongodb.configuration.html
                                • mongodb.constants.html
                                • mongodb.construct.html
                                • mongodb.createcollection.html
                                • mongodb.createdbref.html
                                • mongodb.drop.html
                                • mongodb.dropcollection.html
                                • mongodb.exceptions.html
                                • mongodb.execute.html
                                • mongodb.forceerror.html
                                • mongodb.get.html
                                • mongodb.getcollectioninfo.html
                                • mongodb.getcollectionnames.html
                                • mongodb.getdbref.html
                                • mongodb.getgridfs.html
                                • mongodb.getprofilinglevel.html
                                • mongodb.getreadpreference.html
                                • mongodb.getslaveokay.html
                                • mongodb.getwriteconcern.html
                                • mongodb.installation.hhvm.html
                                • mongodb.installation.html
                                • mongodb.installation.php.html
                                • mongodb.lasterror.html
                                • mongodb.listcollections.html
                                • mongodb.overview.html
                                • mongodb.persistence.html
                                • mongodb.preverror.html
                                • mongodb.repair.html
                                • mongodb.requirements.html
                                • mongodb.reseterror.html
                                • mongodb.selectcollection.html
                                • mongodb.setprofilinglevel.html
                                • mongodb.setreadpreference.html
                                • mongodb.setslaveokay.html
                                • mongodb.setup.html
                                • mongodb.setwriteconcern.html
                                • mongodb.tutorial.html
                                • mongodb.tutorial.install.hhvm.html
                                • mongodb.tutorial.install.html
                                • mongodb.tutorial.install.php.html
                                • mongodb.tutorial.library.html
                                • mongodbref.create.html
                                • mongodbref.get.html
                                • mongodbref.isref.html
                                • mongodeletebatch.construct.html
                                • mongogridfs.construct.html
                                • mongogridfs.delete.html
                                • mongogridfs.drop.html
                                • mongogridfs.find.html
                                • mongogridfs.findone.html
                                • mongogridfs.get.html
                                • mongogridfs.put.html
                                • mongogridfs.remove.html
                                • mongogridfs.storebytes.html
                                • mongogridfs.storefile.html
                                • mongogridfs.storeupload.html
                                • mongogridfscursor.construct.html
                                • mongogridfscursor.current.html
                                • mongogridfscursor.getnext.html
                                • mongogridfscursor.key.html
                                • mongogridfsfile.construct.html
                                • mongogridfsfile.getbytes.html
                                • mongogridfsfile.getfilename.html
                                • mongogridfsfile.getresource.html
                                • mongogridfsfile.getsize.html
                                • mongogridfsfile.write.html
                                • mongoid.construct.html
                                • mongoid.gethostname.html
                                • mongoid.getinc.html
                                • mongoid.getpid.html
                                • mongoid.gettimestamp.html
                                • mongoid.isvalid.html
                                • mongoid.set-state.html
                                • mongoid.tostring.html
                                • mongoinsertbatch.construct.html
                                • mongoint32.construct.html
                                • mongoint32.tostring.html
                                • mongoint64.construct.html
                                • mongoint64.tostring.html
                                • mongolog.getcallback.html
                                • mongolog.getlevel.html
                                • mongolog.getmodule.html
                                • mongolog.setcallback.html
                                • mongolog.setlevel.html
                                • mongolog.setmodule.html
                                • mongopool.getsize.html
                                • mongopool.info.html
                                • mongopool.setsize.html
                                • mongoregex.construct.html
                                • mongoregex.tostring.html
                                • mongoresultexception.getdocument.html
                                • mongotimestamp.construct.html
                                • mongotimestamp.tostring.html
                                • mongoupdatebatch.construct.html
                                • mongowritebatch.add.html
                                • mongowritebatch.construct.html
                                • mongowritebatch.execute.html
                                • mongowriteconcernexception.getdocument.html
                                • mpegfile.construct.html
                                • mpegfile.getaudioproperties.html
                                • mpegfile.getid3v1tag.html
                                • mpegfile.getid3v2tag.html
                                • mqseries.configure.html
                                • mqseries.constants.html
                                • mqseries.ini.html
                                • mqseries.requirements.html
                                • mqseries.resources.html
                                • mqseries.setup.html
                                • msession.configuration.html
                                • msession.constants.html
                                • msession.installation.html
                                • msession.requirements.html
                                • msession.resources.html
                                • msession.setup.html
                                • msql.configuration.html
                                • msql.constants.html
                                • msql.examples-basic.html
                                • msql.examples.html
                                • msql.installation.html
                                • msql.requirements.html
                                • msql.resources.html
                                • msql.setup.html
                                • mssql.configuration.html
                                • mssql.constants.html
                                • mssql.installation.html
                                • mssql.requirements.html
                                • mssql.resources.html
                                • mssql.setup.html
                                • multipleiterator.attachiterator.html
                                • multipleiterator.construct.html
                                • multipleiterator.containsiterator.html
                                • multipleiterator.countiterators.html
                                • multipleiterator.current.html
                                • multipleiterator.detachiterator.html
                                • multipleiterator.getflags.html
                                • multipleiterator.key.html
                                • multipleiterator.next.html
                                • multipleiterator.rewind.html
                                • multipleiterator.setflags.html
                                • multipleiterator.valid.html
                                • mutex.create.html
                                • mutex.destroy.html
                                • mutex.lock.html
                                • mutex.trylock.html
                                • mutex.unlock.html
                                • mysql.configuration.html
                                • mysql.constants.html
                                • mysql.examples-basic.html
                                • mysql.examples.html
                                • mysql.html
                                • mysql.installation.html
                                • mysql.requirements.html
                                • mysql.resources.html
                                • mysql.setup.html
                                • mysqli-driver.embedded-server-end.html
                                • mysqli-driver.embedded-server-start.html
                                • mysqli-driver.report-mode.html
                                • mysqli-result.current-field.html
                                • mysqli-result.data-seek.html
                                • mysqli-result.fetch-all.html
                                • mysqli-result.fetch-array.html
                                • mysqli-result.fetch-assoc.html
                                • mysqli-result.fetch-field-direct.html
                                • mysqli-result.fetch-field.html
                                • mysqli-result.fetch-fields.html
                                • mysqli-result.fetch-object.html
                                • mysqli-result.fetch-row.html
                                • mysqli-result.field-count.html
                                • mysqli-result.field-seek.html
                                • mysqli-result.free.html
                                • mysqli-result.lengths.html
                                • mysqli-result.num-rows.html
                                • mysqli-stmt.affected-rows.html
                                • mysqli-stmt.attr-get.html
                                • mysqli-stmt.attr-set.html
                                • mysqli-stmt.bind-param.html
                                • mysqli-stmt.bind-result.html
                                • mysqli-stmt.close.html
                                • mysqli-stmt.construct.html
                                • mysqli-stmt.data-seek.html
                                • mysqli-stmt.errno.html
                                • mysqli-stmt.error-list.html
                                • mysqli-stmt.error.html
                                • mysqli-stmt.execute.html
                                • mysqli-stmt.fetch.html
                                • mysqli-stmt.field-count.html
                                • mysqli-stmt.free-result.html
                                • mysqli-stmt.get-result.html
                                • mysqli-stmt.get-warnings.html
                                • mysqli-stmt.insert-id.html
                                • mysqli-stmt.more-results.html
                                • mysqli-stmt.next-result.html
                                • mysqli-stmt.num-rows.html
                                • mysqli-stmt.param-count.html
                                • mysqli-stmt.prepare.html
                                • mysqli-stmt.reset.html
                                • mysqli-stmt.result-metadata.html
                                • mysqli-stmt.send-long-data.html
                                • mysqli-stmt.sqlstate.html
                                • mysqli-stmt.store-result.html
                                • mysqli-warning.construct.html
                                • mysqli-warning.next.html
                                • mysqli.affected-rows.html
                                • mysqli.autocommit.html
                                • mysqli.begin-transaction.html
                                • mysqli.change-user.html
                                • mysqli.character-set-name.html
                                • mysqli.client-info.html
                                • mysqli.client-version.html
                                • mysqli.close.html
                                • mysqli.commit.html
                                • mysqli.configuration.html
                                • mysqli.connect-errno.html
                                • mysqli.connect-error.html
                                • mysqli.constants.html
                                • mysqli.construct.html
                                • mysqli.debug.html
                                • mysqli.dump-debug-info.html
                                • mysqli.errno.html
                                • mysqli.error-list.html
                                • mysqli.error.html
                                • mysqli.examples-basic.html
                                • mysqli.examples.html
                                • mysqli.field-count.html
                                • mysqli.get-charset.html
                                • mysqli.get-client-info.html
                                • mysqli.get-client-stats.html
                                • mysqli.get-client-version.html
                                • mysqli.get-connection-stats.html
                                • mysqli.get-host-info.html
                                • mysqli.get-proto-info.html
                                • mysqli.get-server-info.html
                                • mysqli.get-server-version.html
                                • mysqli.get-warnings.html
                                • mysqli.info.html
                                • mysqli.init.html
                                • mysqli.insert-id.html
                                • mysqli.installation.html
                                • mysqli.kill.html
                                • mysqli.more-results.html
                                • mysqli.multi-query.html
                                • mysqli.next-result.html
                                • mysqli.notes.html
                                • mysqli.options.html
                                • mysqli.overview.html
                                • mysqli.persistconns.html
                                • mysqli.ping.html
                                • mysqli.poll.html
                                • mysqli.prepare.html
                                • mysqli.query.html
                                • mysqli.quickstart.connections.html
                                • mysqli.quickstart.dual-interface.html
                                • mysqli.quickstart.html
                                • mysqli.quickstart.metadata.html
                                • mysqli.quickstart.multiple-statement.html
                                • mysqli.quickstart.prepared-statements.html
                                • mysqli.quickstart.statements.html
                                • mysqli.quickstart.stored-procedures.html
                                • mysqli.quickstart.transactions.html
                                • mysqli.real-connect.html
                                • mysqli.real-escape-string.html
                                • mysqli.real-query.html
                                • mysqli.reap-async-query.html
                                • mysqli.refresh.html
                                • mysqli.release-savepoint.html
                                • mysqli.requirements.html
                                • mysqli.resources.html
                                • mysqli.rollback.html
                                • mysqli.rpl-query-type.html
                                • mysqli.savepoint.html
                                • mysqli.select-db.html
                                • mysqli.send-query.html
                                • mysqli.set-charset.html
                                • mysqli.set-local-infile-default.html
                                • mysqli.set-local-infile-handler.html
                                • mysqli.setup.html
                                • mysqli.sqlstate.html
                                • mysqli.ssl-set.html
                                • mysqli.stat.html
                                • mysqli.stmt-init.html
                                • mysqli.store-result.html
                                • mysqli.summary.html
                                • mysqli.thread-id.html
                                • mysqli.thread-safe.html
                                • mysqli.use-result.html
                                • mysqli.warning-count.html
                                • mysqlinfo.api.choosing.html
                                • mysqlinfo.concepts.buffering.html
                                • mysqlinfo.concepts.charset.html
                                • mysqlinfo.concepts.html
                                • mysqlinfo.library.choosing.html
                                • mysqlinfo.terminology.html
                                • mysqlnd-memcache.changes-one-o.html
                                • mysqlnd-memcache.changes.html
                                • mysqlnd-memcache.configuration.html
                                • mysqlnd-memcache.constants.html
                                • mysqlnd-memcache.installation.html
                                • mysqlnd-memcache.quickstart.configuration.html
                                • mysqlnd-memcache.quickstart.html
                                • mysqlnd-memcache.quickstart.usage.html
                                • mysqlnd-memcache.requirements.html
                                • mysqlnd-memcache.setup.html
                                • mysqlnd-ms.architecture.html
                                • mysqlnd-ms.changes-one-five.html
                                • mysqlnd-ms.changes-one-four.html
                                • mysqlnd-ms.changes-one-o.html
                                • mysqlnd-ms.changes-one-one.html
                                • mysqlnd-ms.changes-one-six.html
                                • mysqlnd-ms.changes-one-three.html
                                • mysqlnd-ms.changes-one-two.html
                                • mysqlnd-ms.changes.html
                                • mysqlnd-ms.concepts.html
                                • mysqlnd-ms.concept_cache.html
                                • mysqlnd-ms.concept_xa_trx.html
                                • mysqlnd-ms.configuration.html
                                • mysqlnd-ms.constants.html
                                • mysqlnd-ms.errorhandling.html
                                • mysqlnd-ms.failover.html
                                • mysqlnd-ms.filter.html
                                • mysqlnd-ms.gtid.html
                                • mysqlnd-ms.installation.html
                                • mysqlnd-ms.loadbalancing.html
                                • mysqlnd-ms.plugin-ini-json.html
                                • mysqlnd-ms.pooling.html
                                • mysqlnd-ms.qos-consistency.html
                                • mysqlnd-ms.quickstart.cache.html
                                • mysqlnd-ms.quickstart.configuration.html
                                • mysqlnd-ms.quickstart.connectionpooling.html
                                • mysqlnd-ms.quickstart.failover.html
                                • mysqlnd-ms.quickstart.gtid.html
                                • mysqlnd-ms.quickstart.html
                                • mysqlnd-ms.quickstart.mysql_fabric.html
                                • mysqlnd-ms.quickstart.partitioning.html
                                • mysqlnd-ms.quickstart.qos-consistency.html
                                • mysqlnd-ms.quickstart.sqlhints.html
                                • mysqlnd-ms.quickstart.transactions.html
                                • mysqlnd-ms.quickstart.usage.html
                                • mysqlnd-ms.quickstart.xa_transactions.html
                                • mysqlnd-ms.requirements.html
                                • mysqlnd-ms.rwsplit.html
                                • mysqlnd-ms.setup.html
                                • mysqlnd-ms.supportedclusters.html
                                • mysqlnd-ms.transaction.html
                                • mysqlnd-ms.transient_errors.html
                                • mysqlnd-mux.architecture.html
                                • mysqlnd-mux.changes-one-o.html
                                • mysqlnd-mux.changes.html
                                • mysqlnd-mux.concepts.html
                                • mysqlnd-mux.configuration.html
                                • mysqlnd-mux.connection_pool.html
                                • mysqlnd-mux.constants.html
                                • mysqlnd-mux.installation.html
                                • mysqlnd-mux.requirements.html
                                • mysqlnd-mux.setup.html
                                • mysqlnd-mux.sharing_connections.html
                                • mysqlnd-qc.cache-candidates.html
                                • mysqlnd-qc.cache-efficiency.html
                                • mysqlnd-qc.changes-one-o.html
                                • mysqlnd-qc.changes-one-one.html
                                • mysqlnd-qc.changes-one-two.html
                                • mysqlnd-qc.changes.html
                                • mysqlnd-qc.configuration.html
                                • mysqlnd-qc.constants.html
                                • mysqlnd-qc.installation.html
                                • mysqlnd-qc.pattern-based-caching.html
                                • mysqlnd-qc.per-query-ttl.html
                                • mysqlnd-qc.quickstart.caching.html
                                • mysqlnd-qc.quickstart.concepts.html
                                • mysqlnd-qc.quickstart.configuration.html
                                • mysqlnd-qc.quickstart.html
                                • mysqlnd-qc.requirements.html
                                • mysqlnd-qc.set-user-handlers.html
                                • mysqlnd-qc.setup.html
                                • mysqlnd-qc.slam-defense.html
                                • mysqlnd-uh.changes-one-o.html
                                • mysqlnd-uh.changes.html
                                • mysqlnd-uh.configuration.html
                                • mysqlnd-uh.constants.html
                                • mysqlnd-uh.installation.html
                                • mysqlnd-uh.quickstart.configuration.html
                                • mysqlnd-uh.quickstart.how-it-works.html
                                • mysqlnd-uh.quickstart.html
                                • mysqlnd-uh.quickstart.proxy-installation.html
                                • mysqlnd-uh.quickstart.query-monitoring.html
                                • mysqlnd-uh.requirements.html
                                • mysqlnd-uh.resources.html
                                • mysqlnd-uh.setup.html
                                • mysqlnd.config.html
                                • mysqlnd.incompatibilities.html
                                • mysqlnd.install.html
                                • mysqlnd.memory.html
                                • mysqlnd.notes.html
                                • mysqlnd.overview.html
                                • mysqlnd.persist.html
                                • mysqlnd.plugin.api.html
                                • mysqlnd.plugin.architecture.html
                                • mysqlnd.plugin.developing.html
                                • mysqlnd.plugin.html
                                • mysqlnd.plugin.mysql-proxy.html
                                • mysqlnd.plugin.obtaining.html
                                • mysqlnd.stats.html
                                • mysqlnduhconnection.changeuser.html
                                • mysqlnduhconnection.charsetname.html
                                • mysqlnduhconnection.close.html
                                • mysqlnduhconnection.connect.html
                                • mysqlnduhconnection.construct.html
                                • mysqlnduhconnection.endpsession.html
                                • mysqlnduhconnection.escapestring.html
                                • mysqlnduhconnection.getaffectedrows.html
                                • mysqlnduhconnection.geterrornumber.html
                                • mysqlnduhconnection.geterrorstring.html
                                • mysqlnduhconnection.getfieldcount.html
                                • mysqlnduhconnection.gethostinformation.html
                                • mysqlnduhconnection.getlastinsertid.html
                                • mysqlnduhconnection.getlastmessage.html
                                • mysqlnduhconnection.getprotocolinformation.html
                                • mysqlnduhconnection.getserverinformation.html
                                • mysqlnduhconnection.getserverstatistics.html
                                • mysqlnduhconnection.getserverversion.html
                                • mysqlnduhconnection.getsqlstate.html
                                • mysqlnduhconnection.getstatistics.html
                                • mysqlnduhconnection.getthreadid.html
                                • mysqlnduhconnection.getwarningcount.html
                                • mysqlnduhconnection.init.html
                                • mysqlnduhconnection.killconnection.html
                                • mysqlnduhconnection.listfields.html
                                • mysqlnduhconnection.listmethod.html
                                • mysqlnduhconnection.moreresults.html
                                • mysqlnduhconnection.nextresult.html
                                • mysqlnduhconnection.ping.html
                                • mysqlnduhconnection.query.html
                                • mysqlnduhconnection.queryreadresultsetheader.html
                                • mysqlnduhconnection.reapquery.html
                                • mysqlnduhconnection.refreshserver.html
                                • mysqlnduhconnection.restartpsession.html
                                • mysqlnduhconnection.selectdb.html
                                • mysqlnduhconnection.sendclose.html
                                • mysqlnduhconnection.sendquery.html
                                • mysqlnduhconnection.serverdumpdebuginformation.html
                                • mysqlnduhconnection.setautocommit.html
                                • mysqlnduhconnection.setcharset.html
                                • mysqlnduhconnection.setclientoption.html
                                • mysqlnduhconnection.setserveroption.html
                                • mysqlnduhconnection.shutdownserver.html
                                • mysqlnduhconnection.simplecommand.html
                                • mysqlnduhconnection.simplecommandhandleresponse.html
                                • mysqlnduhconnection.sslset.html
                                • mysqlnduhconnection.stmtinit.html
                                • mysqlnduhconnection.storeresult.html
                                • mysqlnduhconnection.txcommit.html
                                • mysqlnduhconnection.txrollback.html
                                • mysqlnduhconnection.useresult.html
                                • mysqlnduhpreparedstatement.construct.html
                                • mysqlnduhpreparedstatement.execute.html
                                • mysqlnduhpreparedstatement.prepare.html
                                • ncurses.colorconsts.html
                                • ncurses.configuration.html
                                • ncurses.constants.html
                                • ncurses.errconsts.html
                                • ncurses.installation.html
                                • ncurses.keyconsts.html
                                • ncurses.mouseconsts.html
                                • ncurses.requirements.html
                                • ncurses.resources.html
                                • ncurses.setup.html
                                • net-gopher.configuration.html
                                • net-gopher.constants.html
                                • net-gopher.examples-basic.html
                                • net-gopher.examples.html
                                • net-gopher.install.html
                                • net-gopher.requirements.html
                                • net-gopher.resources.html
                                • net-gopher.setup.html
                                • network.configuration.html
                                • network.constants.html
                                • network.installation.html
                                • network.requirements.html
                                • network.resources.html
                                • network.setup.html
                                • newt.configuration.html
                                • newt.constants.html
                                • newt.examples-usage.html
                                • newt.examples.html
                                • newt.installation.html
                                • newt.requirements.html
                                • newt.resources.html
                                • newt.setup.html
                                • nis.configuration.html
                                • nis.constants.html
                                • nis.installation.html
                                • nis.requirements.html
                                • nis.resources.html
                                • nis.setup.html
                                • norewinditerator.construct.html
                                • norewinditerator.current.html
                                • norewinditerator.getinneriterator.html
                                • norewinditerator.key.html
                                • norewinditerator.next.html
                                • norewinditerator.rewind.html
                                • norewinditerator.valid.html
                                • normalizer.isnormalized.html
                                • normalizer.normalize.html
                                • nsapi.configuration.html
                                • nsapi.constants.html
                                • nsapi.installation.html
                                • nsapi.requirements.html
                                • nsapi.resources.html
                                • nsapi.setup.html
                                • numberformatter.create.html
                                • numberformatter.format.html
                                • numberformatter.formatcurrency.html
                                • numberformatter.getattribute.html
                                • numberformatter.geterrorcode.html
                                • numberformatter.geterrormessage.html
                                • numberformatter.getlocale.html
                                • numberformatter.getpattern.html
                                • numberformatter.getsymbol.html
                                • numberformatter.gettextattribute.html
                                • numberformatter.parse.html
                                • numberformatter.parsecurrency.html
                                • numberformatter.setattribute.html
                                • numberformatter.setpattern.html
                                • numberformatter.setsymbol.html
                                • numberformatter.settextattribute.html
                                • oauth.configuration.html
                                • oauth.constants.html
                                • oauth.construct.html
                                • oauth.destruct.html
                                • oauth.disabledebug.html
                                • oauth.disableredirects.html
                                • oauth.disablesslchecks.html
                                • oauth.enabledebug.html
                                • oauth.enableredirects.html
                                • oauth.enablesslchecks.html
                                • oauth.examples.fireeagle.html
                                • oauth.examples.html
                                • oauth.fetch.html
                                • oauth.generatesignature.html
                                • oauth.getaccesstoken.html
                                • oauth.getcapath.html
                                • oauth.getlastresponse.html
                                • oauth.getlastresponseheaders.html
                                • oauth.getlastresponseinfo.html
                                • oauth.getrequestheader.html
                                • oauth.getrequesttoken.html
                                • oauth.installation.html
                                • oauth.requirements.html
                                • oauth.resources.html
                                • oauth.setauthtype.html
                                • oauth.setcapath.html
                                • oauth.setnonce.html
                                • oauth.setrequestengine.html
                                • oauth.setrsacertificate.html
                                • oauth.setsslchecks.html
                                • oauth.settimestamp.html
                                • oauth.settoken.html
                                • oauth.setup.html
                                • oauth.setversion.html
                                • oauthprovider.addrequiredparameter.html
                                • oauthprovider.callconsumerhandler.html
                                • oauthprovider.calltimestampnoncehandler.html
                                • oauthprovider.calltokenhandler.html
                                • oauthprovider.checkoauthrequest.html
                                • oauthprovider.construct.html
                                • oauthprovider.consumerhandler.html
                                • oauthprovider.generatetoken.html
                                • oauthprovider.is2leggedendpoint.html
                                • oauthprovider.isrequesttokenendpoint.html
                                • oauthprovider.removerequiredparameter.html
                                • oauthprovider.reportproblem.html
                                • oauthprovider.setparam.html
                                • oauthprovider.setrequesttokenpath.html
                                • oauthprovider.timestampnoncehandler.html
                                • oauthprovider.tokenhandler.html
                                • oci-collection.append.html
                                • oci-collection.assign.html
                                • oci-collection.assignelem.html
                                • oci-collection.free.html
                                • oci-collection.getelem.html
                                • oci-collection.max.html
                                • oci-collection.size.html
                                • oci-collection.trim.html
                                • oci-lob.append.html
                                • oci-lob.close.html
                                • oci-lob.eof.html
                                • oci-lob.erase.html
                                • oci-lob.export.html
                                • oci-lob.flush.html
                                • oci-lob.free.html
                                • oci-lob.getbuffering.html
                                • oci-lob.import.html
                                • oci-lob.load.html
                                • oci-lob.read.html
                                • oci-lob.rewind.html
                                • oci-lob.save.html
                                • oci-lob.savefile.html
                                • oci-lob.seek.html
                                • oci-lob.setbuffering.html
                                • oci-lob.size.html
                                • oci-lob.tell.html
                                • oci-lob.truncate.html
                                • oci-lob.write.html
                                • oci-lob.writetemporary.html
                                • oci-lob.writetofile.html
                                • oci8.configuration.html
                                • oci8.connection.html
                                • oci8.constants.html
                                • oci8.datatypes.html
                                • oci8.dtrace.html
                                • oci8.examples.html
                                • oci8.fan.html
                                • oci8.installation.html
                                • oci8.requirements.html
                                • oci8.setup.html
                                • oci8.test.html
                                • odbc.configuration.html
                                • odbc.installation.html
                                • oggvorbis.configuration.html
                                • oggvorbis.constants.html
                                • oggvorbis.contexts.html
                                • oggvorbis.examples-basisc.html
                                • oggvorbis.examples.html
                                • oggvorbis.installation.html
                                • oggvorbis.requirements.html
                                • oggvorbis.resources.html
                                • oggvorbis.setup.html
                                • oldaliases.cubrid.html
                                • oldaliases.oci8.html
                                • oop4.constructor.html
                                • oop4.html
                                • oop4.magic-functions.html
                                • oop4.newref.html
                                • oop4.object-comparison.html
                                • oop4.serialization.html
                                • oop5.intro.html
                                • opcache.configuration.html
                                • opcache.installation.html
                                • opcache.requirements.html
                                • opcache.resources.html
                                • opcache.setup.html
                                • openal.configuration.html
                                • openal.constants.html
                                • openal.installation.html
                                • openal.requirements.html
                                • openal.resources.html
                                • openal.setup.html
                                • openssl.cert.verification.html
                                • openssl.certparams.html
                                • openssl.ciphers.html
                                • openssl.configuration.html
                                • openssl.constants.html
                                • openssl.constsni.html
                                • openssl.constversion.html
                                • openssl.installation.html
                                • openssl.key-types.html
                                • openssl.padding.html
                                • openssl.pkcs7.flags.html
                                • openssl.purpose-check.html
                                • openssl.requirements.html
                                • openssl.resources.html
                                • openssl.setup.html
                                • openssl.signature-algos.html
                                • outcontrol.configuration.html
                                • outcontrol.constants.html
                                • outcontrol.examples.basic.html
                                • outcontrol.examples.html
                                • outcontrol.installation.html
                                • outcontrol.requirements.html
                                • outcontrol.resources.html
                                • outcontrol.setup.html
                                • outeriterator.getinneriterator.html
                                • paradox.configuration.html
                                • paradox.constants.html
                                • paradox.installation.html
                                • paradox.requirements.html
                                • paradox.resources.html
                                • paradox.setup.html
                                • parentiterator.accept.html
                                • parentiterator.construct.html
                                • parentiterator.getchildren.html
                                • parentiterator.haschildren.html
                                • parentiterator.next.html
                                • parentiterator.rewind.html
                                • parsekit.configuration.html
                                • parsekit.constants.html
                                • parsekit.installation.html
                                • parsekit.requirements.html
                                • parsekit.resources.html
                                • parsekit.setup.html
                                • password.configuration.html
                                • password.constants.html
                                • password.installation.html
                                • password.requirements.html
                                • password.resources.html
                                • password.setup.html
                                • pcntl.configuration.html
                                • pcntl.constants.html
                                • pcntl.example.html
                                • pcntl.examples.html
                                • pcntl.installation.html
                                • pcntl.requirements.html
                                • pcntl.resources.html
                                • pcntl.setup.html
                                • pcre.configuration.html
                                • pcre.constants.html
                                • pcre.examples.html
                                • pcre.installation.html
                                • pcre.pattern.html
                                • pcre.requirements.html
                                • pcre.resources.html
                                • pcre.setup.html
                                • pdf.configuration.html
                                • pdf.constants.html
                                • pdf.examples-basic.html
                                • pdf.examples.html
                                • pdf.installation.html
                                • pdf.requirements.html
                                • pdf.resources.html
                                • pdf.setup.html
                                • pdo-4d.constants.html
                                • pdo-4d.examples.html
                                • pdo-4d.sqltypes.html
                                • pdo.begintransaction.html
                                • pdo.commit.html
                                • pdo.configuration.html
                                • pdo.connections.html
                                • pdo.constants.html
                                • pdo.construct.html
                                • pdo.cubrid-schema.html
                                • pdo.drivers.html
                                • pdo.error-handling.html
                                • pdo.errorcode.html
                                • pdo.errorinfo.html
                                • pdo.exec.html
                                • pdo.getattribute.html
                                • pdo.getavailabledrivers.html
                                • pdo.installation.html
                                • pdo.intransaction.html
                                • pdo.lastinsertid.html
                                • pdo.lobs.html
                                • pdo.pgsqlcopyfromarray.html
                                • pdo.pgsqlcopyfromfile.html
                                • pdo.pgsqlcopytoarray.html
                                • pdo.pgsqlcopytofile.html
                                • pdo.pgsqlgetnotify.html
                                • pdo.pgsqlgetpid.html
                                • pdo.pgsqllobcreate.html
                                • pdo.pgsqllobopen.html
                                • pdo.pgsqllobunlink.html
                                • pdo.prepare.html
                                • pdo.prepared-statements.html
                                • pdo.query.html
                                • pdo.quote.html
                                • pdo.requirements.html
                                • pdo.resources.html
                                • pdo.rollback.html
                                • pdo.setattribute.html
                                • pdo.setup.html
                                • pdo.sqlitecreateaggregate.html
                                • pdo.sqlitecreatecollation.html
                                • pdo.sqlitecreatefunction.html
                                • pdo.transactions.html
                                • pdostatement.bindcolumn.html
                                • pdostatement.bindparam.html
                                • pdostatement.bindvalue.html
                                • pdostatement.closecursor.html
                                • pdostatement.columncount.html
                                • pdostatement.debugdumpparams.html
                                • pdostatement.errorcode.html
                                • pdostatement.errorinfo.html
                                • pdostatement.execute.html
                                • pdostatement.fetch.html
                                • pdostatement.fetchall.html
                                • pdostatement.fetchcolumn.html
                                • pdostatement.fetchobject.html
                                • pdostatement.getattribute.html
                                • pdostatement.getcolumnmeta.html
                                • pdostatement.nextrowset.html
                                • pdostatement.rowcount.html
                                • pdostatement.setattribute.html
                                • pdostatement.setfetchmode.html
                                • pecl.kadm5.constantsop.html
                                • pgsql.configuration.html
                                • pgsql.constants.html
                                • pgsql.examples-basic.html
                                • pgsql.examples.html
                                • pgsql.installation.html
                                • pgsql.requirements.html
                                • pgsql.resources.html
                                • pgsql.setup.html
                                • phar.addemptydir.html
                                • phar.addfile.html
                                • phar.addfromstring.html
                                • phar.apiversion.html
                                • phar.buildfromdirectory.html
                                • phar.buildfromiterator.html
                                • phar.cancompress.html
                                • phar.canwrite.html
                                • phar.compress.html
                                • phar.compressallfilesbzip2.html
                                • phar.compressallfilesgz.html
                                • phar.compressfiles.html
                                • phar.configuration.html
                                • phar.constants.html
                                • phar.construct.html
                                • phar.converttodata.html
                                • phar.converttoexecutable.html
                                • phar.copy.html
                                • phar.count.html
                                • phar.createdefaultstub.html
                                • phar.creating.html
                                • phar.creating.intro.html
                                • phar.decompress.html
                                • phar.decompressfiles.html
                                • phar.delete.html
                                • phar.delmetadata.html
                                • phar.extractto.html
                                • phar.fileformat.comparison.html
                                • phar.fileformat.flags.html
                                • phar.fileformat.html
                                • phar.fileformat.ingredients.html
                                • phar.fileformat.manifestfile.html
                                • phar.fileformat.phar.html
                                • phar.fileformat.signature.html
                                • phar.fileformat.stub.html
                                • phar.fileformat.tar.html
                                • phar.fileformat.zip.html
                                • phar.getmetadata.html
                                • phar.getmodified.html
                                • phar.getsignature.html
                                • phar.getstub.html
                                • phar.getsupportedcompression.html
                                • phar.getsupportedsignatures.html
                                • phar.getversion.html
                                • phar.hasmetadata.html
                                • phar.installation.html
                                • phar.interceptfilefuncs.html
                                • phar.isbuffering.html
                                • phar.iscompressed.html
                                • phar.isfileformat.html
                                • phar.isvalidpharfilename.html
                                • phar.iswritable.html
                                • phar.loadphar.html
                                • phar.mapphar.html
                                • phar.mount.html
                                • phar.mungserver.html
                                • phar.offsetexists.html
                                • phar.offsetget.html
                                • phar.offsetset.html
                                • phar.offsetunset.html
                                • phar.requirements.html
                                • phar.resources.html
                                • phar.running.html
                                • phar.setalias.html
                                • phar.setdefaultstub.html
                                • phar.setmetadata.html
                                • phar.setsignaturealgorithm.html
                                • phar.setstub.html
                                • phar.setup.html
                                • phar.startbuffering.html
                                • phar.stopbuffering.html
                                • phar.uncompressallfiles.html
                                • phar.unlinkarchive.html
                                • phar.using.html
                                • phar.using.intro.html
                                • phar.using.object.html
                                • phar.using.stream.html
                                • phar.webphar.html
                                • phardata.addemptydir.html
                                • phardata.addfile.html
                                • phardata.addfromstring.html
                                • phardata.buildfromdirectory.html
                                • phardata.buildfromiterator.html
                                • phardata.compress.html
                                • phardata.compressfiles.html
                                • phardata.construct.html
                                • phardata.converttodata.html
                                • phardata.converttoexecutable.html
                                • phardata.copy.html
                                • phardata.decompress.html
                                • phardata.decompressfiles.html
                                • phardata.delete.html
                                • phardata.delmetadata.html
                                • phardata.extractto.html
                                • phardata.iswritable.html
                                • phardata.offsetset.html
                                • phardata.offsetunset.html
                                • phardata.setalias.html
                                • phardata.setdefaultstub.html
                                • phardata.setmetadata.html
                                • phardata.setsignaturealgorithm.html
                                • phardata.setstub.html
                                • pharexception.intro.unused.html
                                • pharfileinfo.chmod.html
                                • pharfileinfo.compress.html
                                • pharfileinfo.construct.html
                                • pharfileinfo.decompress.html
                                • pharfileinfo.delmetadata.html
                                • pharfileinfo.getcompressedsize.html
                                • pharfileinfo.getcrc32.html
                                • pharfileinfo.getmetadata.html
                                • pharfileinfo.getpharflags.html
                                • pharfileinfo.hasmetadata.html
                                • pharfileinfo.iscompressed.html
                                • pharfileinfo.iscompressedbzip2.html
                                • pharfileinfo.iscompressedgz.html
                                • pharfileinfo.iscrcchecked.html
                                • pharfileinfo.setcompressedbzip2.html
                                • pharfileinfo.setcompressedgz.html
                                • pharfileinfo.setmetadata.html
                                • pharfileinfo.setuncompressed.html
                                • php-user-filter.filter.html
                                • php-user-filter.onclose.html
                                • php-user-filter.oncreate.html
                                • pool.collect.html
                                • pool.construct.html
                                • pool.resize.html
                                • pool.shutdown.html
                                • pool.submit.html
                                • pool.submitTo.html
                                • posix.configuration.html
                                • posix.constants.access.html
                                • posix.constants.html
                                • posix.constants.mknod.html
                                • posix.constants.setrlimit.html
                                • posix.installation.html
                                • posix.requirements.html
                                • posix.resources.html
                                • posix.setup.html
                                • preface.html
                                • proctitle.configuration.html
                                • proctitle.constants.html
                                • proctitle.installation.html
                                • proctitle.requirements.html
                                • proctitle.resources.html
                                • proctitle.setup.html
                                • ps.configuration.html
                                • ps.constants.html
                                • ps.installation.html
                                • ps.requirements.html
                                • ps.resources.html
                                • ps.setup.html
                                • pspell.configuration.html
                                • pspell.constants.html
                                • pspell.installation.html
                                • pspell.requirements.html
                                • pspell.resources.html
                                • pspell.setup.html
                                • pthreads.configuration.html
                                • pthreads.constants.html
                                • pthreads.installation.html
                                • pthreads.modifiers.html
                                • pthreads.requirements.html
                                • pthreads.setup.html
                                • quickhash.configuration.html
                                • quickhash.constants.html
                                • quickhash.examples.html
                                • quickhash.installation.html
                                • quickhash.requirements.html
                                • quickhash.setup.html
                                • quickhashinthash.add.html
                                • quickhashinthash.construct.html
                                • quickhashinthash.delete.html
                                • quickhashinthash.exists.html
                                • quickhashinthash.get.html
                                • quickhashinthash.getsize.html
                                • quickhashinthash.loadfromfile.html
                                • quickhashinthash.loadfromstring.html
                                • quickhashinthash.savetofile.html
                                • quickhashinthash.savetostring.html
                                • quickhashinthash.set.html
                                • quickhashinthash.update.html
                                • quickhashintset.add.html
                                • quickhashintset.construct.html
                                • quickhashintset.delete.html
                                • quickhashintset.exists.html
                                • quickhashintset.getsize.html
                                • quickhashintset.loadfromfile.html
                                • quickhashintset.loadfromstring.html
                                • quickhashintset.savetofile.html
                                • quickhashintset.savetostring.html
                                • quickhashintstringhash.add.html
                                • quickhashintstringhash.construct.html
                                • quickhashintstringhash.delete.html
                                • quickhashintstringhash.exists.html
                                • quickhashintstringhash.get.html
                                • quickhashintstringhash.getsize.html
                                • quickhashintstringhash.loadfromfile.html
                                • quickhashintstringhash.loadfromstring.html
                                • quickhashintstringhash.savetofile.html
                                • quickhashintstringhash.savetostring.html
                                • quickhashintstringhash.set.html
                                • quickhashintstringhash.update.html
                                • quickhashstringinthash.add.html
                                • quickhashstringinthash.construct.html
                                • quickhashstringinthash.delete.html
                                • quickhashstringinthash.exists.html
                                • quickhashstringinthash.get.html
                                • quickhashstringinthash.getsize.html
                                • quickhashstringinthash.loadfromfile.html
                                • quickhashstringinthash.loadfromstring.html
                                • quickhashstringinthash.savetofile.html
                                • quickhashstringinthash.savetostring.html
                                • quickhashstringinthash.set.html
                                • quickhashstringinthash.update.html
                                • radius.configuration.html
                                • radius.constants.attributes.html
                                • radius.constants.html
                                • radius.constants.options.html
                                • radius.constants.packets.html
                                • radius.constants.vendor-specific.html
                                • radius.examples.html
                                • radius.installation.html
                                • radius.requirements.html
                                • radius.resources.html
                                • radius.setup.html
                                • rar.configuration.html
                                • rar.constants.html
                                • rar.examples.html
                                • rar.installation.html
                                • rar.requirements.html
                                • rar.resources.html
                                • rar.setup.html
                                • rararchive.close.html
                                • rararchive.getcomment.html
                                • rararchive.getentries.html
                                • rararchive.getentry.html
                                • rararchive.isbroken.html
                                • rararchive.issolid.html
                                • rararchive.open.html
                                • rararchive.setallowbroken.html
                                • rararchive.tostring.html
                                • rarentry.extract.html
                                • rarentry.getattr.html
                                • rarentry.getcrc.html
                                • rarentry.getfiletime.html
                                • rarentry.gethostos.html
                                • rarentry.getmethod.html
                                • rarentry.getname.html
                                • rarentry.getpackedsize.html
                                • rarentry.getstream.html
                                • rarentry.getunpackedsize.html
                                • rarentry.getversion.html
                                • rarentry.isdirectory.html
                                • rarentry.isencrypted.html
                                • rarentry.tostring.html
                                • rarexception.isusingexceptions.html
                                • rarexception.setusingexceptions.html
                                • readline.configuration.html
                                • readline.constants.html
                                • readline.installation.html
                                • readline.requirements.html
                                • readline.resources.html
                                • readline.setup.html
                                • recode.configuration.html
                                • recode.constants.html
                                • recode.installation.html
                                • recode.requirements.html
                                • recode.resources.html
                                • recode.setup.html
                                • recursivearrayiterator.getchildren.html
                                • recursivearrayiterator.haschildren.html
                                • recursivecachingiterator.construct.html
                                • recursivecachingiterator.getchildren.html
                                • recursivecachingiterator.haschildren.html
                                • recursivecallbackfilteriterator.construct.html
                                • recursivecallbackfilteriterator.getchildren.html
                                • recursivecallbackfilteriterator.haschildren.html
                                • recursivedirectoryiterator.construct.html
                                • recursivedirectoryiterator.getchildren.html
                                • recursivedirectoryiterator.getsubpath.html
                                • recursivedirectoryiterator.getsubpathname.html
                                • recursivedirectoryiterator.haschildren.html
                                • recursivedirectoryiterator.key.html
                                • recursivedirectoryiterator.next.html
                                • recursivedirectoryiterator.rewind.html
                                • recursivefilteriterator.construct.html
                                • recursivefilteriterator.getchildren.html
                                • recursivefilteriterator.haschildren.html
                                • recursiveiterator.getchildren.html
                                • recursiveiterator.haschildren.html
                                • recursiveiteratoriterator.beginchildren.html
                                • recursiveiteratoriterator.beginiteration.html
                                • recursiveiteratoriterator.callgetchildren.html
                                • recursiveiteratoriterator.callhaschildren.html
                                • recursiveiteratoriterator.construct.html
                                • recursiveiteratoriterator.current.html
                                • recursiveiteratoriterator.endchildren.html
                                • recursiveiteratoriterator.enditeration.html
                                • recursiveiteratoriterator.getdepth.html
                                • recursiveiteratoriterator.getinneriterator.html
                                • recursiveiteratoriterator.getmaxdepth.html
                                • recursiveiteratoriterator.getsubiterator.html
                                • recursiveiteratoriterator.key.html
                                • recursiveiteratoriterator.next.html
                                • recursiveiteratoriterator.nextelement.html
                                • recursiveiteratoriterator.rewind.html
                                • recursiveiteratoriterator.setmaxdepth.html
                                • recursiveiteratoriterator.valid.html
                                • recursiveregexiterator.construct.html
                                • recursiveregexiterator.getchildren.html
                                • recursiveregexiterator.haschildren.html
                                • recursivetreeiterator.beginchildren.html
                                • recursivetreeiterator.beginiteration.html
                                • recursivetreeiterator.callgetchildren.html
                                • recursivetreeiterator.callhaschildren.html
                                • recursivetreeiterator.construct.html
                                • recursivetreeiterator.current.html
                                • recursivetreeiterator.endchildren.html
                                • recursivetreeiterator.enditeration.html
                                • recursivetreeiterator.getentry.html
                                • recursivetreeiterator.getpostfix.html
                                • recursivetreeiterator.getprefix.html
                                • recursivetreeiterator.key.html
                                • recursivetreeiterator.next.html
                                • recursivetreeiterator.nextelement.html
                                • recursivetreeiterator.rewind.html
                                • recursivetreeiterator.setprefixpart.html
                                • recursivetreeiterator.valid.html
                                • ref.apache.html
                                • ref.apc.html
                                • ref.apcu.html
                                • ref.apd.html
                                • ref.array.html
                                • ref.bbcode.html
                                • ref.bc.html
                                • ref.bcompiler.html
                                • ref.blenc.html
                                • ref.bson.html
                                • ref.bzip2.html
                                • ref.cairo.html
                                • ref.calendar.html
                                • ref.chdb.html
                                • ref.classkit.html
                                • ref.classobj.html
                                • ref.com.html
                                • ref.crack.html
                                • ref.csprng.html
                                • ref.ctype.html
                                • ref.cubrid.html
                                • ref.curl.html
                                • ref.cyrus.html
                                • ref.datetime.html
                                • ref.dba.html
                                • ref.dbase.html
                                • ref.dbplus.html
                                • ref.dbx.html
                                • ref.dio.html
                                • ref.dir.html
                                • ref.dom.html
                                • ref.eio.html
                                • ref.enchant.html
                                • ref.errorfunc.html
                                • ref.exec.html
                                • ref.exif.html
                                • ref.expect.html
                                • ref.fam.html
                                • ref.fann.html
                                • ref.fbsql.html
                                • ref.fdf.html
                                • ref.fileinfo.html
                                • ref.filepro.html
                                • ref.filesystem.html
                                • ref.filter.html
                                • ref.fpm.html
                                • ref.fribidi.html
                                • ref.ftp.html
                                • ref.funchand.html
                                • ref.geoip.html
                                • ref.gettext.html
                                • ref.gmp.html
                                • ref.gnupg.html
                                • ref.gupnp.html
                                • ref.hash.html
                                • ref.http.html
                                • ref.hwapi.html
                                • ref.ibase.html
                                • ref.ibm-db2.html
                                • ref.iconv.html
                                • ref.id3.html
                                • ref.ifx.html
                                • ref.iisfunc.html
                                • ref.image.html
                                • ref.imap.html
                                • ref.inclued.html
                                • ref.info.html
                                • ref.ingres.html
                                • ref.inotify.html
                                • ref.intl.grapheme.html
                                • ref.intl.html
                                • ref.intl.idn.html
                                • ref.json.html
                                • ref.judy.html
                                • ref.kadm5.html
                                • ref.ldap.html
                                • ref.libevent.html
                                • ref.libxml.html
                                • ref.lzf.html
                                • ref.mail.html
                                • ref.mailparse.html
                                • ref.math.html
                                • ref.maxdb.html
                                • ref.mbstring.html
                                • ref.mcrypt.html
                                • ref.mcve.html
                                • ref.memcache.html
                                • ref.mhash.html
                                • ref.ming.html
                                • ref.misc.html
                                • ref.mnogosearch.html
                                • ref.mongo.html
                                • ref.mqseries.html
                                • ref.msession.html
                                • ref.msql.html
                                • ref.mssql.html
                                • ref.mysql.html
                                • ref.mysqli.html
                                • ref.mysqlnd-memcache.html
                                • ref.mysqlnd-ms.html
                                • ref.mysqlnd-qc.html
                                • ref.mysqlnd-uh.html
                                • ref.ncurses.html
                                • ref.net-gopher.html
                                • ref.network.html
                                • ref.newt.html
                                • ref.nis.html
                                • ref.nsapi.html
                                • ref.oauth.html
                                • ref.oci8.html
                                • ref.opcache.html
                                • ref.openal.html
                                • ref.openssl.html
                                • ref.outcontrol.html
                                • ref.paradox.html
                                • ref.parsekit.html
                                • ref.password.html
                                • ref.pcntl.html
                                • ref.pcre.html
                                • ref.pdf.html
                                • ref.pdo-4d.connection.html
                                • ref.pdo-4d.html
                                • ref.pdo-4d.sql4d.html
                                • ref.pdo-cubrid.connection.html
                                • ref.pdo-cubrid.html
                                • ref.pdo-dblib.connection.html
                                • ref.pdo-dblib.html
                                • ref.pdo-firebird.connection.html
                                • ref.pdo-firebird.html
                                • ref.pdo-ibm.connection.html
                                • ref.pdo-ibm.html
                                • ref.pdo-informix.connection.html
                                • ref.pdo-informix.html
                                • ref.pdo-mysql.connection.html
                                • ref.pdo-mysql.html
                                • ref.pdo-oci.connection.html
                                • ref.pdo-oci.html
                                • ref.pdo-odbc.connection.html
                                • ref.pdo-odbc.html
                                • ref.pdo-pgsql.connection.html
                                • ref.pdo-pgsql.html
                                • ref.pdo-sqlite.connection.html
                                • ref.pdo-sqlite.html
                                • ref.pdo-sqlsrv.connection.html
                                • ref.pdo-sqlsrv.html
                                • ref.pgsql.html
                                • ref.posix.html
                                • ref.proctitle.html
                                • ref.ps.html
                                • ref.pspell.html
                                • ref.radius.html
                                • ref.rar.html
                                • ref.readline.html
                                • ref.recode.html
                                • ref.regex.html
                                • ref.rpmreader.html
                                • ref.rrd.html
                                • ref.runkit.html
                                • ref.sam.html
                                • ref.sca.html
                                • ref.sdo-das-xml.html
                                • ref.sdo.html
                                • ref.sdodasrel.html
                                • ref.sem.html
                                • ref.session-pgsql.html
                                • ref.session.html
                                • ref.shmop.html
                                • ref.simplexml.html
                                • ref.snmp.html
                                • ref.soap.html
                                • ref.sockets.html
                                • ref.solr.html
                                • ref.spl.html
                                • ref.spplus.html
                                • ref.sqlite.html
                                • ref.sqlsrv.html
                                • ref.ssdeep.html
                                • ref.ssh2.html
                                • ref.stats.html
                                • ref.stomp.html
                                • ref.stream.html
                                • ref.strings.html
                                • ref.svn.html
                                • ref.swish.html
                                • ref.sybase.html
                                • ref.taint.html
                                • ref.tcpwrap.html
                                • ref.tidy.html
                                • ref.tokenizer.html
                                • ref.trader.html
                                • ref.uodbc.html
                                • ref.uopz.html
                                • ref.url.html
                                • ref.var.html
                                • ref.vpopmail.html
                                • ref.wddx.html
                                • ref.win32ps.html
                                • ref.win32service.html
                                • ref.wincache.html
                                • ref.xattr.html
                                • ref.xdiff.html
                                • ref.xhprof.html
                                • ref.xml.html
                                • ref.xmlrpc.html
                                • ref.xmlwriter.html
                                • ref.yaml.html
                                • ref.yaz.html
                                • ref.zip.html
                                • ref.zlib.html
                                • reference.pcre.pattern.differences.html
                                • reference.pcre.pattern.modifiers.html
                                • reference.pcre.pattern.posix.html
                                • reference.pcre.pattern.syntax.html
                                • reflection.configuration.html
                                • reflection.constants.html
                                • reflection.examples.html
                                • reflection.export.html
                                • reflection.extending.html
                                • reflection.getmodifiernames.html
                                • reflection.installation.html
                                • reflection.requirements.html
                                • reflection.resources.html
                                • reflection.setup.html
                                • reflectionclass.construct.html
                                • reflectionclass.export.html
                                • reflectionclass.getconstant.html
                                • reflectionclass.getconstants.html
                                • reflectionclass.getconstructor.html
                                • reflectionclass.getdefaultproperties.html
                                • reflectionclass.getdoccomment.html
                                • reflectionclass.getendline.html
                                • reflectionclass.getextension.html
                                • reflectionclass.getextensionname.html
                                • reflectionclass.getfilename.html
                                • reflectionclass.getinterfacenames.html
                                • reflectionclass.getinterfaces.html
                                • reflectionclass.getmethod.html
                                • reflectionclass.getmethods.html
                                • reflectionclass.getmodifiers.html
                                • reflectionclass.getname.html
                                • reflectionclass.getnamespacename.html
                                • reflectionclass.getparentclass.html
                                • reflectionclass.getproperties.html
                                • reflectionclass.getproperty.html
                                • reflectionclass.getshortname.html
                                • reflectionclass.getstartline.html
                                • reflectionclass.getstaticproperties.html
                                • reflectionclass.getstaticpropertyvalue.html
                                • reflectionclass.gettraitaliases.html
                                • reflectionclass.gettraitnames.html
                                • reflectionclass.gettraits.html
                                • reflectionclass.hasconstant.html
                                • reflectionclass.hasmethod.html
                                • reflectionclass.hasproperty.html
                                • reflectionclass.implementsinterface.html
                                • reflectionclass.innamespace.html
                                • reflectionclass.isabstract.html
                                • reflectionclass.iscloneable.html
                                • reflectionclass.isfinal.html
                                • reflectionclass.isinstance.html
                                • reflectionclass.isinstantiable.html
                                • reflectionclass.isinterface.html
                                • reflectionclass.isinternal.html
                                • reflectionclass.isiterateable.html
                                • reflectionclass.issubclassof.html
                                • reflectionclass.istrait.html
                                • reflectionclass.isuserdefined.html
                                • reflectionclass.newinstance.html
                                • reflectionclass.newinstanceargs.html
                                • reflectionclass.newinstancewithoutconstructor.html
                                • reflectionclass.setstaticpropertyvalue.html
                                • reflectionclass.tostring.html
                                • reflectionextension.clone.html
                                • reflectionextension.construct.html
                                • reflectionextension.export.html
                                • reflectionextension.getclasses.html
                                • reflectionextension.getclassnames.html
                                • reflectionextension.getconstants.html
                                • reflectionextension.getdependencies.html
                                • reflectionextension.getfunctions.html
                                • reflectionextension.getinientries.html
                                • reflectionextension.getname.html
                                • reflectionextension.getversion.html
                                • reflectionextension.info.html
                                • reflectionextension.ispersistent.html
                                • reflectionextension.istemporary.html
                                • reflectionextension.tostring.html
                                • reflectionfunction.construct.html
                                • reflectionfunction.export.html
                                • reflectionfunction.getclosure.html
                                • reflectionfunction.invoke.html
                                • reflectionfunction.invokeargs.html
                                • reflectionfunction.isdisabled.html
                                • reflectionfunction.tostring.html
                                • reflectionfunctionabstract.clone.html
                                • reflectionfunctionabstract.getclosurescopeclass.html
                                • reflectionfunctionabstract.getclosurethis.html
                                • reflectionfunctionabstract.getdoccomment.html
                                • reflectionfunctionabstract.getendline.html
                                • reflectionfunctionabstract.getextension.html
                                • reflectionfunctionabstract.getextensionname.html
                                • reflectionfunctionabstract.getfilename.html
                                • reflectionfunctionabstract.getname.html
                                • reflectionfunctionabstract.getnamespacename.html
                                • reflectionfunctionabstract.getnumberofparameters.html
                                • reflectionfunctionabstract.getnumberofrequiredparameters.html
                                • reflectionfunctionabstract.getparameters.html
                                • reflectionfunctionabstract.getreturntype.html
                                • reflectionfunctionabstract.getshortname.html
                                • reflectionfunctionabstract.getstartline.html
                                • reflectionfunctionabstract.getstaticvariables.html
                                • reflectionfunctionabstract.hasreturntype.html
                                • reflectionfunctionabstract.innamespace.html
                                • reflectionfunctionabstract.isclosure.html
                                • reflectionfunctionabstract.isdeprecated.html
                                • reflectionfunctionabstract.isgenerator.html
                                • reflectionfunctionabstract.isinternal.html
                                • reflectionfunctionabstract.isuserdefined.html
                                • reflectionfunctionabstract.isvariadic.html
                                • reflectionfunctionabstract.returnsreference.html
                                • reflectionfunctionabstract.tostring.html
                                • reflectiongenerator.construct.html
                                • reflectiongenerator.getexecutingfile.html
                                • reflectiongenerator.getexecutinggenerator.html
                                • reflectiongenerator.getexecutingline.html
                                • reflectiongenerator.getfunction.html
                                • reflectiongenerator.getthis.html
                                • reflectiongenerator.gettrace.html
                                • reflectionmethod.construct.html
                                • reflectionmethod.export.html
                                • reflectionmethod.getclosure.html
                                • reflectionmethod.getdeclaringclass.html
                                • reflectionmethod.getmodifiers.html
                                • reflectionmethod.getprototype.html
                                • reflectionmethod.invoke.html
                                • reflectionmethod.invokeargs.html
                                • reflectionmethod.isabstract.html
                                • reflectionmethod.isconstructor.html
                                • reflectionmethod.isdestructor.html
                                • reflectionmethod.isfinal.html
                                • reflectionmethod.isprivate.html
                                • reflectionmethod.isprotected.html
                                • reflectionmethod.ispublic.html
                                • reflectionmethod.isstatic.html
                                • reflectionmethod.setaccessible.html
                                • reflectionmethod.tostring.html
                                • reflectionobject.construct.html
                                • reflectionobject.export.html
                                • reflectionparameter.allowsnull.html
                                • reflectionparameter.canbepassedbyvalue.html
                                • reflectionparameter.clone.html
                                • reflectionparameter.construct.html
                                • reflectionparameter.export.html
                                • reflectionparameter.getclass.html
                                • reflectionparameter.getdeclaringclass.html
                                • reflectionparameter.getdeclaringfunction.html
                                • reflectionparameter.getdefaultvalue.html
                                • reflectionparameter.getdefaultvalueconstantname.html
                                • reflectionparameter.getname.html
                                • reflectionparameter.getposition.html
                                • reflectionparameter.gettype.html
                                • reflectionparameter.hastype.html
                                • reflectionparameter.isarray.html
                                • reflectionparameter.iscallable.html
                                • reflectionparameter.isdefaultvalueavailable.html
                                • reflectionparameter.isdefaultvalueconstant.html
                                • reflectionparameter.isoptional.html
                                • reflectionparameter.ispassedbyreference.html
                                • reflectionparameter.isvariadic.html
                                • reflectionparameter.tostring.html
                                • reflectionproperty.clone.html
                                • reflectionproperty.construct.html
                                • reflectionproperty.export.html
                                • reflectionproperty.getdeclaringclass.html
                                • reflectionproperty.getdoccomment.html
                                • reflectionproperty.getmodifiers.html
                                • reflectionproperty.getname.html
                                • reflectionproperty.getvalue.html
                                • reflectionproperty.isdefault.html
                                • reflectionproperty.isprivate.html
                                • reflectionproperty.isprotected.html
                                • reflectionproperty.ispublic.html
                                • reflectionproperty.isstatic.html
                                • reflectionproperty.setaccessible.html
                                • reflectionproperty.setvalue.html
                                • reflectionproperty.tostring.html
                                • reflectiontype.allowsnull.html
                                • reflectiontype.isbuiltin.html
                                • reflectiontype.tostring.html
                                • reflectionzendextension.clone.html
                                • reflectionzendextension.construct.html
                                • reflectionzendextension.export.html
                                • reflectionzendextension.getauthor.html
                                • reflectionzendextension.getcopyright.html
                                • reflectionzendextension.getname.html
                                • reflectionzendextension.geturl.html
                                • reflectionzendextension.getversion.html
                                • reflectionzendextension.tostring.html
                                • reflector.export.html
                                • reflector.tostring.html
                                • refs.basic.other.html
                                • refs.basic.php.html
                                • refs.basic.session.html
                                • refs.basic.text.html
                                • refs.basic.vartype.html
                                • refs.calendar.html
                                • refs.compression.html
                                • refs.creditcard.html
                                • refs.crypto.html
                                • refs.database.abstract.html
                                • refs.database.html
                                • refs.database.vendors.html
                                • refs.fileprocess.file.html
                                • refs.fileprocess.process.html
                                • refs.international.html
                                • refs.math.html
                                • refs.remote.auth.html
                                • refs.remote.mail.html
                                • refs.remote.other.html
                                • refs.search.html
                                • refs.utilspec.audio.html
                                • refs.utilspec.cmdline.html
                                • refs.utilspec.image.html
                                • refs.utilspec.nontext.html
                                • refs.utilspec.server.html
                                • refs.utilspec.windows.html
                                • refs.webservice.html
                                • refs.xml.html
                                • regex.configuration.html
                                • regex.constants.html
                                • regex.examples.html
                                • regex.installation.html
                                • regex.requirements.html
                                • regex.resources.html
                                • regex.setup.html
                                • regexiterator.accept.html
                                • regexiterator.construct.html
                                • regexiterator.getflags.html
                                • regexiterator.getmode.html
                                • regexiterator.getpregflags.html
                                • regexiterator.getregex.html
                                • regexiterator.setflags.html
                                • regexiterator.setmode.html
                                • regexiterator.setpregflags.html
                                • regexp.introduction.html
                                • regexp.reference.alternation.html
                                • regexp.reference.anchors.html
                                • regexp.reference.assertions.html
                                • regexp.reference.back-references.html
                                • regexp.reference.character-classes.html
                                • regexp.reference.comments.html
                                • regexp.reference.conditional.html
                                • regexp.reference.delimiters.html
                                • regexp.reference.dot.html
                                • regexp.reference.escape.html
                                • regexp.reference.internal-options.html
                                • regexp.reference.meta.html
                                • regexp.reference.onlyonce.html
                                • regexp.reference.performance.html
                                • regexp.reference.recursive.html
                                • regexp.reference.repetition.html
                                • regexp.reference.subpatterns.html
                                • regexp.reference.unicode.html
                                • reserved.classes.html
                                • reserved.constants.html
                                • reserved.exceptions.html
                                • reserved.html
                                • reserved.interfaces.html
                                • reserved.keywords.html
                                • reserved.other-reserved-words.html
                                • reserved.variables.argc.html
                                • reserved.variables.argv.html
                                • reserved.variables.cookies.html
                                • reserved.variables.environment.html
                                • reserved.variables.files.html
                                • reserved.variables.get.html
                                • reserved.variables.globals.html
                                • reserved.variables.html
                                • reserved.variables.httprawpostdata.html
                                • reserved.variables.httpresponseheader.html
                                • reserved.variables.phperrormsg.html
                                • reserved.variables.post.html
                                • reserved.variables.request.html
                                • reserved.variables.server.html
                                • reserved.variables.session.html
                                • resource.html
                                • resourcebundle.count.html
                                • resourcebundle.create.html
                                • resourcebundle.get.html
                                • resourcebundle.geterrorcode.html
                                • resourcebundle.geterrormessage.html
                                • resourcebundle.locales.html
                                • rpmreader.configuration.html
                                • rpmreader.constants.html
                                • rpmreader.examples-basic.html
                                • rpmreader.examples.html
                                • rpmreader.installation.html
                                • rpmreader.requirements.html
                                • rpmreader.resources.html
                                • rpmreader.setup.html
                                • rrd.configuration.html
                                • rrd.constants.html
                                • rrd.examples-oop.html
                                • rrd.examples-procedural.html
                                • rrd.examples.html
                                • rrd.installation.html
                                • rrd.requirements.html
                                • rrd.resources.html
                                • rrd.setup.html
                                • rrdcreator.addarchive.html
                                • rrdcreator.adddatasource.html
                                • rrdcreator.construct.html
                                • rrdcreator.save.html
                                • rrdgraph.construct.html
                                • rrdgraph.save.html
                                • rrdgraph.saveverbose.html
                                • rrdgraph.setoptions.html
                                • rrdupdater.construct.html
                                • rrdupdater.update.html
                                • runkit.configuration.html
                                • runkit.constants.html
                                • runkit.installation.html
                                • runkit.requirements.html
                                • runkit.resources.html
                                • runkit.sandbox-parent.html
                                • runkit.sandbox.html
                                • runkit.setup.html
                                • sam.configuration.html
                                • sam.connections.html
                                • sam.constants.html
                                • sam.errors.html
                                • sam.examples.html
                                • sam.installation.html
                                • sam.messages.html
                                • sam.operations.html
                                • sam.pubsub.html
                                • sam.requirements.html
                                • sam.resources.html
                                • sam.setup.html
                                • samconnection.commit.html
                                • samconnection.connect.html
                                • samconnection.construct.html
                                • samconnection.disconnect.html
                                • samconnection.errno.html
                                • samconnection.error.html
                                • samconnection.isconnected.html
                                • samconnection.peek.html
                                • samconnection.peekall.html
                                • samconnection.receive.html
                                • samconnection.remove.html
                                • samconnection.rollback.html
                                • samconnection.send.html
                                • samconnection.setdebug.html
                                • samconnection.subscribe.html
                                • samconnection.unsubscribe.html
                                • sammessage.body.html
                                • sammessage.construct.html
                                • sammessage.header.html
                                • sca-localproxy.createdataobject.html
                                • sca-soapproxy.createdataobject.html
                                • sca.configuration.html
                                • sca.constants.html
                                • sca.createdataobject.html
                                • sca.examples.calling.html
                                • sca.examples.deploy.html
                                • sca.examples.errorhandling.html
                                • sca.examples.exposing-webservice.html
                                • sca.examples.html
                                • sca.examples.nonscascript.html
                                • sca.examples.obtaining-wsdl.html
                                • sca.examples.proxies.html
                                • sca.examples.structure.html
                                • sca.examples.structures.html
                                • sca.examples.understanding-wsdl.html
                                • sca.getservice.html
                                • sca.installation.html
                                • sca.requirements.html
                                • sca.resources.html
                                • sca.setup.html
                                • scream.configuration.html
                                • scream.examples-simple.html
                                • scream.examples.html
                                • scream.installation.html
                                • scream.requirements.html
                                • scream.resources.html
                                • scream.setup.html
                                • sdo-das-changesummary.beginlogging.html
                                • sdo-das-changesummary.endlogging.html
                                • sdo-das-changesummary.getchangeddataobjects.html
                                • sdo-das-changesummary.getchangetype.html
                                • sdo-das-changesummary.getoldcontainer.html
                                • sdo-das-changesummary.getoldvalues.html
                                • sdo-das-changesummary.islogging.html
                                • sdo-das-datafactory.addpropertytotype.html
                                • sdo-das-datafactory.addtype.html
                                • sdo-das-datafactory.getdatafactory.html
                                • sdo-das-dataobject.getchangesummary.html
                                • sdo-das-relational.applychanges.html
                                • sdo-das-relational.construct.html
                                • sdo-das-relational.createrootdataobject.html
                                • sdo-das-relational.executepreparedquery.html
                                • sdo-das-relational.executequery.html
                                • sdo-das-setting.getlistindex.html
                                • sdo-das-setting.getpropertyindex.html
                                • sdo-das-setting.getpropertyname.html
                                • sdo-das-setting.getvalue.html
                                • sdo-das-setting.isset.html
                                • sdo-das-xml-document.getrootdataobject.html
                                • sdo-das-xml-document.getrootelementname.html
                                • sdo-das-xml-document.getrootelementuri.html
                                • sdo-das-xml-document.setencoding.html
                                • sdo-das-xml-document.setxmldeclaration.html
                                • sdo-das-xml-document.setxmlversion.html
                                • sdo-das-xml.addtypes.html
                                • sdo-das-xml.configuration.html
                                • sdo-das-xml.constants.html
                                • sdo-das-xml.create.html
                                • sdo-das-xml.createdataobject.html
                                • sdo-das-xml.createdocument.html
                                • sdo-das-xml.examples.html
                                • sdo-das-xml.installation.html
                                • sdo-das-xml.loadfile.html
                                • sdo-das-xml.loadstring.html
                                • sdo-das-xml.requirements.html
                                • sdo-das-xml.resources.html
                                • sdo-das-xml.savefile.html
                                • sdo-das-xml.savestring.html
                                • sdo-das-xml.setup.html
                                • sdo-datafactory.create.html
                                • sdo-dataobject.clear.html
                                • sdo-dataobject.createdataobject.html
                                • sdo-dataobject.getcontainer.html
                                • sdo-dataobject.getsequence.html
                                • sdo-dataobject.gettypename.html
                                • sdo-dataobject.gettypenamespaceuri.html
                                • sdo-exception.getcause.html
                                • sdo-list.insert.html
                                • sdo-model-property.getcontainingtype.html
                                • sdo-model-property.getdefault.html
                                • sdo-model-property.getname.html
                                • sdo-model-property.gettype.html
                                • sdo-model-property.iscontainment.html
                                • sdo-model-property.ismany.html
                                • sdo-model-reflectiondataobject.construct.html
                                • sdo-model-reflectiondataobject.export.html
                                • sdo-model-reflectiondataobject.getcontainmentproperty.html
                                • sdo-model-reflectiondataobject.getinstanceproperties.html
                                • sdo-model-reflectiondataobject.gettype.html
                                • sdo-model-type.getbasetype.html
                                • sdo-model-type.getname.html
                                • sdo-model-type.getnamespaceuri.html
                                • sdo-model-type.getproperties.html
                                • sdo-model-type.getproperty.html
                                • sdo-model-type.isabstracttype.html
                                • sdo-model-type.isdatatype.html
                                • sdo-model-type.isinstance.html
                                • sdo-model-type.isopentype.html
                                • sdo-model-type.issequencedtype.html
                                • sdo-sequence.getproperty.html
                                • sdo-sequence.insert.html
                                • sdo-sequence.move.html
                                • sdo.configuration.html
                                • sdo.constants.html
                                • sdo.examples-basic.html
                                • sdo.examples.html
                                • sdo.installation.html
                                • sdo.limitations.html
                                • sdo.requirements.html
                                • sdo.resources.html
                                • sdo.sample.getset.html
                                • sdo.sample.reflection.html
                                • sdo.sample.sequence.html
                                • sdo.setup.html
                                • sdodasrel.configuration.html
                                • sdodasrel.constants.html
                                • sdodasrel.examples-crud.html
                                • sdodasrel.examples.html
                                • sdodasrel.examples.one-table.html
                                • sdodasrel.examples.three-table.html
                                • sdodasrel.examples.two-table.html
                                • sdodasrel.installation.html
                                • sdodasrel.limitations.html
                                • sdodasrel.metadata.html
                                • sdodasrel.requirements.html
                                • sdodasrel.resources.html
                                • sdodasrel.setup.html
                                • search-description.json
                                • search-index.json
                                • security.apache.html
                                • security.cgi-bin.attacks.html
                                • security.cgi-bin.default.html
                                • security.cgi-bin.doc-root.html
                                • security.cgi-bin.force-redirect.html
                                • security.cgi-bin.html
                                • security.cgi-bin.shell.html
                                • security.current.html
                                • security.database.connection.html
                                • security.database.design.html
                                • security.database.html
                                • security.database.sql-injection.html
                                • security.database.storage.html
                                • security.errors.html
                                • security.filesystem.html
                                • security.filesystem.nullbytes.html
                                • security.general.html
                                • security.globals.html
                                • security.hiding.html
                                • security.html
                                • security.intro.html
                                • security.magicquotes.disabling.html
                                • security.magicquotes.html
                                • security.magicquotes.what.html
                                • security.magicquotes.why.html
                                • security.magicquotes.whynot.html
                                • security.variables.html
                                • seekableiterator.seek.html
                                • sem.configuration.html
                                • sem.constants.html
                                • sem.installation.html
                                • sem.requirements.html
                                • sem.resources.html
                                • sem.setup.html
                                • serializable.serialize.html
                                • serializable.unserialize.html
                                • session-pgsql.configuration.html
                                • session-pgsql.constants.html
                                • session-pgsql.installation.html
                                • session-pgsql.requirements.html
                                • session-pgsql.resources.html
                                • session-pgsql.setup.html
                                • session-pgsql.tables.html
                                • session.configuration.html
                                • session.constants.html
                                • session.customhandler.html
                                • session.examples.basic.html
                                • session.examples.html
                                • session.idpassing.html
                                • session.installation.html
                                • session.requirements.html
                                • session.resources.html
                                • session.security.html
                                • session.setup.html
                                • session.upload-progress.html
                                • sessionhandler.close.html
                                • sessionhandler.create-sid.html
                                • sessionhandler.destroy.html
                                • sessionhandler.gc.html
                                • sessionhandler.open.html
                                • sessionhandler.read.html
                                • sessionhandler.write.html
                                • sessionhandlerinterface.close.html
                                • sessionhandlerinterface.destroy.html
                                • sessionhandlerinterface.gc.html
                                • sessionhandlerinterface.open.html
                                • sessionhandlerinterface.read.html
                                • sessionhandlerinterface.write.html
                                • set.mongodb.html
                                • set.mysqlinfo.html
                                • shmop.configuration.html
                                • shmop.constants.html
                                • shmop.examples-basic.html
                                • shmop.examples.html
                                • shmop.installation.html
                                • shmop.requirements.html
                                • shmop.resources.html
                                • shmop.setup.html
                                • simplexml.configuration.html
                                • simplexml.constants.html
                                • simplexml.examples-basic.html
                                • simplexml.examples-errors.html
                                • simplexml.examples.html
                                • simplexml.installation.html
                                • simplexml.requirements.html
                                • simplexml.resources.html
                                • simplexml.setup.html
                                • simplexmlelement.addattribute.html
                                • simplexmlelement.addchild.html
                                • simplexmlelement.asxml.html
                                • simplexmlelement.attributes.html
                                • simplexmlelement.children.html
                                • simplexmlelement.construct.html
                                • simplexmlelement.count.html
                                • simplexmlelement.getdocnamespaces.html
                                • simplexmlelement.getname.html
                                • simplexmlelement.getnamespaces.html
                                • simplexmlelement.registerxpathnamespace.html
                                • simplexmlelement.savexml.html
                                • simplexmlelement.tostring.html
                                • simplexmlelement.xpath.html
                                • simplexmliterator.current.html
                                • simplexmliterator.getchildren.html
                                • simplexmliterator.haschildren.html
                                • simplexmliterator.key.html
                                • simplexmliterator.next.html
                                • simplexmliterator.rewind.html
                                • simplexmliterator.valid.html
                                • snmp.close.html
                                • snmp.configuration.html
                                • snmp.constants.html
                                • snmp.construct.html
                                • snmp.get.html
                                • snmp.geterrno.html
                                • snmp.geterror.html
                                • snmp.getnext.html
                                • snmp.installation.html
                                • snmp.requirements.html
                                • snmp.resources.html
                                • snmp.set.html
                                • snmp.setsecurity.html
                                • snmp.setup.html
                                • snmp.walk.html
                                • soap.configuration.html
                                • soap.constants.html
                                • soap.installation.html
                                • soap.requirements.html
                                • soap.resources.html
                                • soap.setup.html
                                • soapclient.call.html
                                • soapclient.construct.html
                                • soapclient.dorequest.html
                                • soapclient.getfunctions.html
                                • soapclient.getlastrequest.html
                                • soapclient.getlastrequestheaders.html
                                • soapclient.getlastresponse.html
                                • soapclient.getlastresponseheaders.html
                                • soapclient.gettypes.html
                                • soapclient.setcookie.html
                                • soapclient.setlocation.html
                                • soapclient.setsoapheaders.html
                                • soapclient.soapcall.html
                                • soapclient.soapclient.html
                                • soapfault.construct.html
                                • soapfault.soapfault.html
                                • soapfault.tostring.html
                                • soapheader.construct.html
                                • soapheader.soapheader.html
                                • soapparam.construct.html
                                • soapparam.soapparam.html
                                • soapserver.addfunction.html
                                • soapserver.addsoapheader.html
                                • soapserver.construct.html
                                • soapserver.fault.html
                                • soapserver.getfunctions.html
                                • soapserver.handle.html
                                • soapserver.setclass.html
                                • soapserver.setobject.html
                                • soapserver.setpersistence.html
                                • soapserver.soapserver.html
                                • soapvar.construct.html
                                • soapvar.soapvar.html
                                • sockets.configuration.html
                                • sockets.constants.html
                                • sockets.errors.html
                                • sockets.examples.html
                                • sockets.installation.html
                                • sockets.requirements.html
                                • sockets.resources.html
                                • sockets.setup.html
                                • solr.configuration.html
                                • solr.constants.html
                                • solr.examples.html
                                • solr.installation.html
                                • solr.requirements.html
                                • solr.resources.html
                                • solr.setup.html
                                • solrclient.adddocument.html
                                • solrclient.adddocuments.html
                                • solrclient.commit.html
                                • solrclient.construct.html
                                • solrclient.deletebyid.html
                                • solrclient.deletebyids.html
                                • solrclient.deletebyqueries.html
                                • solrclient.deletebyquery.html
                                • solrclient.destruct.html
                                • solrclient.getbyid.html
                                • solrclient.getbyids.html
                                • solrclient.getdebug.html
                                • solrclient.getoptions.html
                                • solrclient.optimize.html
                                • solrclient.ping.html
                                • solrclient.query.html
                                • solrclient.request.html
                                • solrclient.rollback.html
                                • solrclient.setresponsewriter.html
                                • solrclient.setservlet.html
                                • solrclient.system.html
                                • solrclient.threads.html
                                • solrclientexception.getinternalinfo.html
                                • solrcollapsefunction.construct.html
                                • solrcollapsefunction.getfield.html
                                • solrcollapsefunction.gethint.html
                                • solrcollapsefunction.getmax.html
                                • solrcollapsefunction.getmin.html
                                • solrcollapsefunction.getnullpolicy.html
                                • solrcollapsefunction.getsize.html
                                • solrcollapsefunction.setfield.html
                                • solrcollapsefunction.sethint.html
                                • solrcollapsefunction.setmax.html
                                • solrcollapsefunction.setmin.html
                                • solrcollapsefunction.setnullpolicy.html
                                • solrcollapsefunction.setsize.html
                                • solrcollapsefunction.tostring.html
                                • solrdismaxquery.addbigramphrasefield.html
                                • solrdismaxquery.addboostquery.html
                                • solrdismaxquery.addphrasefield.html
                                • solrdismaxquery.addqueryfield.html
                                • solrdismaxquery.addtrigramphrasefield.html
                                • solrdismaxquery.adduserfield.html
                                • solrdismaxquery.construct.html
                                • solrdismaxquery.removebigramphrasefield.html
                                • solrdismaxquery.removeboostquery.html
                                • solrdismaxquery.removephrasefield.html
                                • solrdismaxquery.removequeryfield.html
                                • solrdismaxquery.removetrigramphrasefield.html
                                • solrdismaxquery.removeuserfield.html
                                • solrdismaxquery.setbigramphrasefields.html
                                • solrdismaxquery.setbigramphraseslop.html
                                • solrdismaxquery.setboostfunction.html
                                • solrdismaxquery.setboostquery.html
                                • solrdismaxquery.setminimummatch.html
                                • solrdismaxquery.setphrasefields.html
                                • solrdismaxquery.setphraseslop.html
                                • solrdismaxquery.setqueryalt.html
                                • solrdismaxquery.setqueryphraseslop.html
                                • solrdismaxquery.settiebreaker.html
                                • solrdismaxquery.settrigramphrasefields.html
                                • solrdismaxquery.settrigramphraseslop.html
                                • solrdismaxquery.setuserfields.html
                                • solrdismaxquery.usedismaxqueryparser.html
                                • solrdismaxquery.useedismaxqueryparser.html
                                • solrdocument.addfield.html
                                • solrdocument.clear.html
                                • solrdocument.clone.html
                                • solrdocument.construct.html
                                • solrdocument.current.html
                                • solrdocument.deletefield.html
                                • solrdocument.destruct.html
                                • solrdocument.fieldexists.html
                                • solrdocument.get.html
                                • solrdocument.getfield.html
                                • solrdocument.getfieldcount.html
                                • solrdocument.getfieldnames.html
                                • solrdocument.getinputdocument.html
                                • solrdocument.isset.html
                                • solrdocument.key.html
                                • solrdocument.merge.html
                                • solrdocument.next.html
                                • solrdocument.offsetexists.html
                                • solrdocument.offsetget.html
                                • solrdocument.offsetset.html
                                • solrdocument.offsetunset.html
                                • solrdocument.reset.html
                                • solrdocument.rewind.html
                                • solrdocument.serialize.html
                                • solrdocument.set.html
                                • solrdocument.sort.html
                                • solrdocument.toarray.html
                                • solrdocument.unserialize.html
                                • solrdocument.unset.html
                                • solrdocument.valid.html
                                • solrdocumentfield.construct.html
                                • solrdocumentfield.destruct.html
                                • solrexception.getinternalinfo.html
                                • solrgenericresponse.construct.html
                                • solrgenericresponse.destruct.html
                                • solrillegalargumentexception.getinternalinfo.html
                                • solrillegaloperationexception.getinternalinfo.html
                                • solrinputdocument.addfield.html
                                • solrinputdocument.clear.html
                                • solrinputdocument.clone.html
                                • solrinputdocument.construct.html
                                • solrinputdocument.deletefield.html
                                • solrinputdocument.destruct.html
                                • solrinputdocument.fieldexists.html
                                • solrinputdocument.getboost.html
                                • solrinputdocument.getfield.html
                                • solrinputdocument.getfieldboost.html
                                • solrinputdocument.getfieldcount.html
                                • solrinputdocument.getfieldnames.html
                                • solrinputdocument.merge.html
                                • solrinputdocument.reset.html
                                • solrinputdocument.setboost.html
                                • solrinputdocument.setfieldboost.html
                                • solrinputdocument.sort.html
                                • solrinputdocument.toarray.html
                                • solrmodifiableparams.construct.html
                                • solrmodifiableparams.destruct.html
                                • solrobject.construct.html
                                • solrobject.destruct.html
                                • solrobject.getpropertynames.html
                                • solrobject.offsetexists.html
                                • solrobject.offsetget.html
                                • solrobject.offsetset.html
                                • solrobject.offsetunset.html
                                • solrparams.add.html
                                • solrparams.addparam.html
                                • solrparams.get.html
                                • solrparams.getparam.html
                                • solrparams.getparams.html
                                • solrparams.getpreparedparams.html
                                • solrparams.serialize.html
                                • solrparams.set.html
                                • solrparams.setparam.html
                                • solrparams.tostring.html
                                • solrparams.unserialize.html
                                • solrpingresponse.construct.html
                                • solrpingresponse.destruct.html
                                • solrpingresponse.getresponse.html
                                • solrquery.addexpandfilterquery.html
                                • solrquery.addexpandsortfield.html
                                • solrquery.addfacetdatefield.html
                                • solrquery.addfacetdateother.html
                                • solrquery.addfacetfield.html
                                • solrquery.addfacetquery.html
                                • solrquery.addfield.html
                                • solrquery.addfilterquery.html
                                • solrquery.addgroupfield.html
                                • solrquery.addgroupfunction.html
                                • solrquery.addgroupquery.html
                                • solrquery.addgroupsortfield.html
                                • solrquery.addhighlightfield.html
                                • solrquery.addmltfield.html
                                • solrquery.addmltqueryfield.html
                                • solrquery.addsortfield.html
                                • solrquery.addstatsfacet.html
                                • solrquery.addstatsfield.html
                                • solrquery.collapse.html
                                • solrquery.construct.html
                                • solrquery.destruct.html
                                • solrquery.getexpand.html
                                • solrquery.getexpandfilterqueries.html
                                • solrquery.getexpandquery.html
                                • solrquery.getexpandrows.html
                                • solrquery.getexpandsortfields.html
                                • solrquery.getfacet.html
                                • solrquery.getfacetdateend.html
                                • solrquery.getfacetdatefields.html
                                • solrquery.getfacetdategap.html
                                • solrquery.getfacetdatehardend.html
                                • solrquery.getfacetdateother.html
                                • solrquery.getfacetdatestart.html
                                • solrquery.getfacetfields.html
                                • solrquery.getfacetlimit.html
                                • solrquery.getfacetmethod.html
                                • solrquery.getfacetmincount.html
                                • solrquery.getfacetmissing.html
                                • solrquery.getfacetoffset.html
                                • solrquery.getfacetprefix.html
                                • solrquery.getfacetqueries.html
                                • solrquery.getfacetsort.html
                                • solrquery.getfields.html
                                • solrquery.getfilterqueries.html
                                • solrquery.getgroup.html
                                • solrquery.getgroupcachepercent.html
                                • solrquery.getgroupfacet.html
                                • solrquery.getgroupfields.html
                                • solrquery.getgroupformat.html
                                • solrquery.getgroupfunctions.html
                                • solrquery.getgrouplimit.html
                                • solrquery.getgroupmain.html
                                • solrquery.getgroupngroups.html
                                • solrquery.getgroupoffset.html
                                • solrquery.getgroupqueries.html
                                • solrquery.getgroupsortfields.html
                                • solrquery.getgrouptruncate.html
                                • solrquery.gethighlight.html
                                • solrquery.gethighlightalternatefield.html
                                • solrquery.gethighlightfields.html
                                • solrquery.gethighlightformatter.html
                                • solrquery.gethighlightfragmenter.html
                                • solrquery.gethighlightfragsize.html
                                • solrquery.gethighlighthighlightmultiterm.html
                                • solrquery.gethighlightmaxalternatefieldlength.html
                                • solrquery.gethighlightmaxanalyzedchars.html
                                • solrquery.gethighlightmergecontiguous.html
                                • solrquery.gethighlightregexmaxanalyzedchars.html
                                • solrquery.gethighlightregexpattern.html
                                • solrquery.gethighlightregexslop.html
                                • solrquery.gethighlightrequirefieldmatch.html
                                • solrquery.gethighlightsimplepost.html
                                • solrquery.gethighlightsimplepre.html
                                • solrquery.gethighlightsnippets.html
                                • solrquery.gethighlightusephrasehighlighter.html
                                • solrquery.getmlt.html
                                • solrquery.getmltboost.html
                                • solrquery.getmltcount.html
                                • solrquery.getmltfields.html
                                • solrquery.getmltmaxnumqueryterms.html
                                • solrquery.getmltmaxnumtokens.html
                                • solrquery.getmltmaxwordlength.html
                                • solrquery.getmltmindocfrequency.html
                                • solrquery.getmltmintermfrequency.html
                                • solrquery.getmltminwordlength.html
                                • solrquery.getmltqueryfields.html
                                • solrquery.getquery.html
                                • solrquery.getrows.html
                                • solrquery.getsortfields.html
                                • solrquery.getstart.html
                                • solrquery.getstats.html
                                • solrquery.getstatsfacets.html
                                • solrquery.getstatsfields.html
                                • solrquery.getterms.html
                                • solrquery.gettermsfield.html
                                • solrquery.gettermsincludelowerbound.html
                                • solrquery.gettermsincludeupperbound.html
                                • solrquery.gettermslimit.html
                                • solrquery.gettermslowerbound.html
                                • solrquery.gettermsmaxcount.html
                                • solrquery.gettermsmincount.html
                                • solrquery.gettermsprefix.html
                                • solrquery.gettermsreturnraw.html
                                • solrquery.gettermssort.html
                                • solrquery.gettermsupperbound.html
                                • solrquery.gettimeallowed.html
                                • solrquery.removeexpandfilterquery.html
                                • solrquery.removeexpandsortfield.html
                                • solrquery.removefacetdatefield.html
                                • solrquery.removefacetdateother.html
                                • solrquery.removefacetfield.html
                                • solrquery.removefacetquery.html
                                • solrquery.removefield.html
                                • solrquery.removefilterquery.html
                                • solrquery.removehighlightfield.html
                                • solrquery.removemltfield.html
                                • solrquery.removemltqueryfield.html
                                • solrquery.removesortfield.html
                                • solrquery.removestatsfacet.html
                                • solrquery.removestatsfield.html
                                • solrquery.setechohandler.html
                                • solrquery.setechoparams.html
                                • solrquery.setexpand.html
                                • solrquery.setexpandquery.html
                                • solrquery.setexpandrows.html
                                • solrquery.setexplainother.html
                                • solrquery.setfacet.html
                                • solrquery.setfacetdateend.html
                                • solrquery.setfacetdategap.html
                                • solrquery.setfacetdatehardend.html
                                • solrquery.setfacetdatestart.html
                                • solrquery.setfacetenumcachemindefaultfrequency.html
                                • solrquery.setfacetlimit.html
                                • solrquery.setfacetmethod.html
                                • solrquery.setfacetmincount.html
                                • solrquery.setfacetmissing.html
                                • solrquery.setfacetoffset.html
                                • solrquery.setfacetprefix.html
                                • solrquery.setfacetsort.html
                                • solrquery.setgroup.html
                                • solrquery.setgroupcachepercent.html
                                • solrquery.setgroupfacet.html
                                • solrquery.setgroupformat.html
                                • solrquery.setgrouplimit.html
                                • solrquery.setgroupmain.html
                                • solrquery.setgroupngroups.html
                                • solrquery.setgroupoffset.html
                                • solrquery.setgrouptruncate.html
                                • solrquery.sethighlight.html
                                • solrquery.sethighlightalternatefield.html
                                • solrquery.sethighlightformatter.html
                                • solrquery.sethighlightfragmenter.html
                                • solrquery.sethighlightfragsize.html
                                • solrquery.sethighlighthighlightmultiterm.html
                                • solrquery.sethighlightmaxalternatefieldlength.html
                                • solrquery.sethighlightmaxanalyzedchars.html
                                • solrquery.sethighlightmergecontiguous.html
                                • solrquery.sethighlightregexmaxanalyzedchars.html
                                • solrquery.sethighlightregexpattern.html
                                • solrquery.sethighlightregexslop.html
                                • solrquery.sethighlightrequirefieldmatch.html
                                • solrquery.sethighlightsimplepost.html
                                • solrquery.sethighlightsimplepre.html
                                • solrquery.sethighlightsnippets.html
                                • solrquery.sethighlightusephrasehighlighter.html
                                • solrquery.setmlt.html
                                • solrquery.setmltboost.html
                                • solrquery.setmltcount.html
                                • solrquery.setmltmaxnumqueryterms.html
                                • solrquery.setmltmaxnumtokens.html
                                • solrquery.setmltmaxwordlength.html
                                • solrquery.setmltmindocfrequency.html
                                • solrquery.setmltmintermfrequency.html
                                • solrquery.setmltminwordlength.html
                                • solrquery.setomitheader.html
                                • solrquery.setquery.html
                                • solrquery.setrows.html
                                • solrquery.setshowdebuginfo.html
                                • solrquery.setstart.html
                                • solrquery.setstats.html
                                • solrquery.setterms.html
                                • solrquery.settermsfield.html
                                • solrquery.settermsincludelowerbound.html
                                • solrquery.settermsincludeupperbound.html
                                • solrquery.settermslimit.html
                                • solrquery.settermslowerbound.html
                                • solrquery.settermsmaxcount.html
                                • solrquery.settermsmincount.html
                                • solrquery.settermsprefix.html
                                • solrquery.settermsreturnraw.html
                                • solrquery.settermssort.html
                                • solrquery.settermsupperbound.html
                                • solrquery.settimeallowed.html
                                • solrqueryresponse.construct.html
                                • solrqueryresponse.destruct.html
                                • solrresponse.getdigestedresponse.html
                                • solrresponse.gethttpstatus.html
                                • solrresponse.gethttpstatusmessage.html
                                • solrresponse.getrawrequest.html
                                • solrresponse.getrawrequestheaders.html
                                • solrresponse.getrawresponse.html
                                • solrresponse.getrawresponseheaders.html
                                • solrresponse.getrequesturl.html
                                • solrresponse.getresponse.html
                                • solrresponse.setparsemode.html
                                • solrresponse.success.html
                                • solrserverexception.getinternalinfo.html
                                • solrupdateresponse.construct.html
                                • solrupdateresponse.destruct.html
                                • solrutils.digestxmlresponse.html
                                • solrutils.escapequerychars.html
                                • solrutils.getsolrversion.html
                                • solrutils.queryphrase.html
                                • sphinx.configuration.html
                                • sphinx.constants.html
                                • sphinx.examples.html
                                • sphinx.installation.html
                                • sphinx.requirements.html
                                • sphinx.resources.html
                                • sphinx.setup.html
                                • sphinxclient.addquery.html
                                • sphinxclient.buildexcerpts.html
                                • sphinxclient.buildkeywords.html
                                • sphinxclient.close.html
                                • sphinxclient.construct.html
                                • sphinxclient.escapestring.html
                                • sphinxclient.getlasterror.html
                                • sphinxclient.getlastwarning.html
                                • sphinxclient.open.html
                                • sphinxclient.query.html
                                • sphinxclient.resetfilters.html
                                • sphinxclient.resetgroupby.html
                                • sphinxclient.runqueries.html
                                • sphinxclient.setarrayresult.html
                                • sphinxclient.setconnecttimeout.html
                                • sphinxclient.setfieldweights.html
                                • sphinxclient.setfilter.html
                                • sphinxclient.setfilterfloatrange.html
                                • sphinxclient.setfilterrange.html
                                • sphinxclient.setgeoanchor.html
                                • sphinxclient.setgroupby.html
                                • sphinxclient.setgroupdistinct.html
                                • sphinxclient.setidrange.html
                                • sphinxclient.setindexweights.html
                                • sphinxclient.setlimits.html
                                • sphinxclient.setmatchmode.html
                                • sphinxclient.setmaxquerytime.html
                                • sphinxclient.setoverride.html
                                • sphinxclient.setrankingmode.html
                                • sphinxclient.setretries.html
                                • sphinxclient.setselect.html
                                • sphinxclient.setserver.html
                                • sphinxclient.setsortmode.html
                                • sphinxclient.status.html
                                • sphinxclient.updateattributes.html
                                • spl-types.configuration.html
                                • spl-types.installation.html
                                • spl-types.requirements.html
                                • spl-types.resources.html
                                • spl-types.setup.html
                                • spl.configuration.html
                                • spl.constants.html
                                • spl.datastructures.html
                                • spl.exceptions.html
                                • spl.files.html
                                • spl.installation.html
                                • spl.interfaces.html
                                • spl.iterators.html
                                • spl.misc.html
                                • spl.requirements.html
                                • spl.resources.html
                                • spl.setup.html
                                • spldoublylinkedlist.add.html
                                • spldoublylinkedlist.bottom.html
                                • spldoublylinkedlist.construct.html
                                • spldoublylinkedlist.count.html
                                • spldoublylinkedlist.current.html
                                • spldoublylinkedlist.getiteratormode.html
                                • spldoublylinkedlist.isempty.html
                                • spldoublylinkedlist.key.html
                                • spldoublylinkedlist.next.html
                                • spldoublylinkedlist.offsetexists.html
                                • spldoublylinkedlist.offsetget.html
                                • spldoublylinkedlist.offsetset.html
                                • spldoublylinkedlist.offsetunset.html
                                • spldoublylinkedlist.pop.html
                                • spldoublylinkedlist.prev.html
                                • spldoublylinkedlist.push.html
                                • spldoublylinkedlist.rewind.html
                                • spldoublylinkedlist.serialize.html
                                • spldoublylinkedlist.setiteratormode.html
                                • spldoublylinkedlist.shift.html
                                • spldoublylinkedlist.top.html
                                • spldoublylinkedlist.unserialize.html
                                • spldoublylinkedlist.unshift.html
                                • spldoublylinkedlist.valid.html
                                • splenum.getconstlist.html
                                • splfileinfo.construct.html
                                • splfileinfo.getatime.html
                                • splfileinfo.getbasename.html
                                • splfileinfo.getctime.html
                                • splfileinfo.getextension.html
                                • splfileinfo.getfileinfo.html
                                • splfileinfo.getfilename.html
                                • splfileinfo.getgroup.html
                                • splfileinfo.getinode.html
                                • splfileinfo.getlinktarget.html
                                • splfileinfo.getmtime.html
                                • splfileinfo.getowner.html
                                • splfileinfo.getpath.html
                                • splfileinfo.getpathinfo.html
                                • splfileinfo.getpathname.html
                                • splfileinfo.getperms.html
                                • splfileinfo.getrealpath.html
                                • splfileinfo.getsize.html
                                • splfileinfo.gettype.html
                                • splfileinfo.isdir.html
                                • splfileinfo.isexecutable.html
                                • splfileinfo.isfile.html
                                • splfileinfo.islink.html
                                • splfileinfo.isreadable.html
                                • splfileinfo.iswritable.html
                                • splfileinfo.openfile.html
                                • splfileinfo.setfileclass.html
                                • splfileinfo.setinfoclass.html
                                • splfileinfo.tostring.html
                                • splfileobject.construct.html
                                • splfileobject.current.html
                                • splfileobject.eof.html
                                • splfileobject.fflush.html
                                • splfileobject.fgetc.html
                                • splfileobject.fgetcsv.html
                                • splfileobject.fgets.html
                                • splfileobject.fgetss.html
                                • splfileobject.flock.html
                                • splfileobject.fpassthru.html
                                • splfileobject.fputcsv.html
                                • splfileobject.fread.html
                                • splfileobject.fscanf.html
                                • splfileobject.fseek.html
                                • splfileobject.fstat.html
                                • splfileobject.ftell.html
                                • splfileobject.ftruncate.html
                                • splfileobject.fwrite.html
                                • splfileobject.getchildren.html
                                • splfileobject.getcsvcontrol.html
                                • splfileobject.getcurrentline.html
                                • splfileobject.getflags.html
                                • splfileobject.getmaxlinelen.html
                                • splfileobject.haschildren.html
                                • splfileobject.key.html
                                • splfileobject.next.html
                                • splfileobject.rewind.html
                                • splfileobject.seek.html
                                • splfileobject.setcsvcontrol.html
                                • splfileobject.setflags.html
                                • splfileobject.setmaxlinelen.html
                                • splfileobject.tostring.html
                                • splfileobject.valid.html
                                • splfixedarray.construct.html
                                • splfixedarray.count.html
                                • splfixedarray.current.html
                                • splfixedarray.fromarray.html
                                • splfixedarray.getsize.html
                                • splfixedarray.key.html
                                • splfixedarray.next.html
                                • splfixedarray.offsetexists.html
                                • splfixedarray.offsetget.html
                                • splfixedarray.offsetset.html
                                • splfixedarray.offsetunset.html
                                • splfixedarray.rewind.html
                                • splfixedarray.setsize.html
                                • splfixedarray.toarray.html
                                • splfixedarray.valid.html
                                • splfixedarray.wakeup.html
                                • splheap.compare.html
                                • splheap.construct.html
                                • splheap.count.html
                                • splheap.current.html
                                • splheap.extract.html
                                • splheap.insert.html
                                • splheap.isempty.html
                                • splheap.key.html
                                • splheap.next.html
                                • splheap.recoverfromcorruption.html
                                • splheap.rewind.html
                                • splheap.top.html
                                • splheap.valid.html
                                • splmaxheap.compare.html
                                • splminheap.compare.html
                                • splobjectstorage.addall.html
                                • splobjectstorage.attach.html
                                • splobjectstorage.contains.html
                                • splobjectstorage.count.html
                                • splobjectstorage.current.html
                                • splobjectstorage.detach.html
                                • splobjectstorage.gethash.html
                                • splobjectstorage.getinfo.html
                                • splobjectstorage.key.html
                                • splobjectstorage.next.html
                                • splobjectstorage.offsetexists.html
                                • splobjectstorage.offsetget.html
                                • splobjectstorage.offsetset.html
                                • splobjectstorage.offsetunset.html
                                • splobjectstorage.removeall.html
                                • splobjectstorage.removeallexcept.html
                                • splobjectstorage.rewind.html
                                • splobjectstorage.serialize.html
                                • splobjectstorage.setinfo.html
                                • splobjectstorage.unserialize.html
                                • splobjectstorage.valid.html
                                • splobserver.update.html
                                • splpriorityqueue.compare.html
                                • splpriorityqueue.construct.html
                                • splpriorityqueue.count.html
                                • splpriorityqueue.current.html
                                • splpriorityqueue.extract.html
                                • splpriorityqueue.insert.html
                                • splpriorityqueue.isempty.html
                                • splpriorityqueue.key.html
                                • splpriorityqueue.next.html
                                • splpriorityqueue.recoverfromcorruption.html
                                • splpriorityqueue.rewind.html
                                • splpriorityqueue.setextractflags.html
                                • splpriorityqueue.top.html
                                • splpriorityqueue.valid.html
                                • splqueue.construct.html
                                • splqueue.dequeue.html
                                • splqueue.enqueue.html
                                • splqueue.setiteratormode.html
                                • splstack.construct.html
                                • splstack.setiteratormode.html
                                • splsubject.attach.html
                                • splsubject.detach.html
                                • splsubject.notify.html
                                • spltempfileobject.construct.html
                                • spltype.construct.html
                                • spoofchecker.areconfusable.html
                                • spoofchecker.construct.html
                                • spoofchecker.issuspicious.html
                                • spoofchecker.setallowedlocales.html
                                • spoofchecker.setchecks.html
                                • spplus.configuration.html
                                • spplus.constants.html
                                • spplus.installation.html
                                • spplus.requirements.html
                                • spplus.resources.html
                                • spplus.setup.html
                                • sqlite.configuration.html
                                • sqlite.constants.html
                                • sqlite.installation.html
                                • sqlite.requirements.html
                                • sqlite.resources.html
                                • sqlite.setup.html
                                • sqlite3.busytimeout.html
                                • sqlite3.changes.html
                                • sqlite3.close.html
                                • sqlite3.configuration.html
                                • sqlite3.constants.html
                                • sqlite3.construct.html
                                • sqlite3.createaggregate.html
                                • sqlite3.createcollation.html
                                • sqlite3.createfunction.html
                                • sqlite3.escapestring.html
                                • sqlite3.exec.html
                                • sqlite3.installation.html
                                • sqlite3.lasterrorcode.html
                                • sqlite3.lasterrormsg.html
                                • sqlite3.lastinsertrowid.html
                                • sqlite3.loadextension.html
                                • sqlite3.open.html
                                • sqlite3.prepare.html
                                • sqlite3.query.html
                                • sqlite3.querysingle.html
                                • sqlite3.requirements.html
                                • sqlite3.resources.html
                                • sqlite3.setup.html
                                • sqlite3.version.html
                                • sqlite3result.columnname.html
                                • sqlite3result.columntype.html
                                • sqlite3result.fetcharray.html
                                • sqlite3result.finalize.html
                                • sqlite3result.numcolumns.html
                                • sqlite3result.reset.html
                                • sqlite3stmt.bindparam.html
                                • sqlite3stmt.bindvalue.html
                                • sqlite3stmt.clear.html
                                • sqlite3stmt.close.html
                                • sqlite3stmt.execute.html
                                • sqlite3stmt.paramcount.html
                                • sqlite3stmt.reset.html
                                • sqlsrv.configuration.html
                                • sqlsrv.constants.html
                                • sqlsrv.installation.html
                                • sqlsrv.requirements.html
                                • sqlsrv.resources.html
                                • sqlsrv.setup.html
                                • ssdeep.configuration.html
                                • ssdeep.constants.html
                                • ssdeep.installation.html
                                • ssdeep.requirements.html
                                • ssdeep.resources.html
                                • ssdeep.setup.html
                                • ssh2.configuration.html
                                • ssh2.constants.html
                                • ssh2.installation.html
                                • ssh2.requirements.html
                                • ssh2.resources.html
                                • ssh2.setup.html
                                • stats.configuration.html
                                • stats.constants.html
                                • stats.installation.html
                                • stats.requirements.html
                                • stats.resources.html
                                • stats.setup.html
                                • stomp.abort.html
                                • stomp.ack.html
                                • stomp.begin.html
                                • stomp.commit.html
                                • stomp.configuration.html
                                • stomp.construct.html
                                • stomp.destruct.html
                                • stomp.error.html
                                • stomp.examples.html
                                • stomp.getdetails.html
                                • stomp.getreadtimeout.html
                                • stomp.getsessionid.html
                                • stomp.hasframe.html
                                • stomp.installation.html
                                • stomp.readframe.html
                                • stomp.requirements.html
                                • stomp.resources.html
                                • stomp.send.html
                                • stomp.setreadtimeout.html
                                • stomp.setup.html
                                • stomp.subscribe.html
                                • stomp.unsubscribe.html
                                • stompframe.construct.html
                                • stream.configuration.html
                                • stream.constants.html
                                • stream.contexts.html
                                • stream.errors.html
                                • stream.examples.html
                                • stream.filters.html
                                • stream.installation.html
                                • stream.requirements.html
                                • stream.resources.html
                                • stream.setup.html
                                • stream.streamwrapper.example-1.html
                                • streamwrapper.construct.html
                                • streamwrapper.destruct.html
                                • streamwrapper.dir-closedir.html
                                • streamwrapper.dir-opendir.html
                                • streamwrapper.dir-readdir.html
                                • streamwrapper.dir-rewinddir.html
                                • streamwrapper.mkdir.html
                                • streamwrapper.rename.html
                                • streamwrapper.rmdir.html
                                • streamwrapper.stream-cast.html
                                • streamwrapper.stream-close.html
                                • streamwrapper.stream-eof.html
                                • streamwrapper.stream-flush.html
                                • streamwrapper.stream-lock.html
                                • streamwrapper.stream-metadata.html
                                • streamwrapper.stream-open.html
                                • streamwrapper.stream-read.html
                                • streamwrapper.stream-seek.html
                                • streamwrapper.stream-set-option.html
                                • streamwrapper.stream-stat.html
                                • streamwrapper.stream-tell.html
                                • streamwrapper.stream-truncate.html
                                • streamwrapper.stream-write.html
                                • streamwrapper.unlink.html
                                • streamwrapper.url-stat.html
                                • string.constants.html
                                • strings.configuration.html
                                • strings.installation.html
                                • strings.requirements.html
                                • strings.resources.html
                                • strings.setup.html
                                • svm.configuration.html
                                • svm.construct.html
                                • svm.crossvalidate.html
                                • svm.examples.html
                                • svm.getoptions.html
                                • svm.installation.html
                                • svm.requirements.html
                                • svm.resources.html
                                • svm.setoptions.html
                                • svm.setup.html
                                • svm.train.html
                                • svmmodel.checkprobabilitymodel.html
                                • svmmodel.construct.html
                                • svmmodel.getlabels.html
                                • svmmodel.getnrclass.html
                                • svmmodel.getsvmtype.html
                                • svmmodel.getsvrprobability.html
                                • svmmodel.load.html
                                • svmmodel.predict-probability.html
                                • svmmodel.predict.html
                                • svmmodel.save.html
                                • svn.configuration.html
                                • svn.constants.html
                                • svn.installation.html
                                • svn.requirements.html
                                • svn.resources.html
                                • svn.setup.html
                                • swfaction.construct.html
                                • swfbitmap.construct.html
                                • swfbitmap.getheight.html
                                • swfbitmap.getwidth.html
                                • swfbutton.addaction.html
                                • swfbutton.addasound.html
                                • swfbutton.addshape.html
                                • swfbutton.construct.html
                                • swfbutton.setaction.html
                                • swfbutton.setdown.html
                                • swfbutton.sethit.html
                                • swfbutton.setmenu.html
                                • swfbutton.setover.html
                                • swfbutton.setup.html
                                • swfdisplayitem.addaction.html
                                • swfdisplayitem.addcolor.html
                                • swfdisplayitem.endmask.html
                                • swfdisplayitem.getrot.html
                                • swfdisplayitem.getx.html
                                • swfdisplayitem.getxscale.html
                                • swfdisplayitem.getxskew.html
                                • swfdisplayitem.gety.html
                                • swfdisplayitem.getyscale.html
                                • swfdisplayitem.getyskew.html
                                • swfdisplayitem.move.html
                                • swfdisplayitem.moveto.html
                                • swfdisplayitem.multcolor.html
                                • swfdisplayitem.remove.html
                                • swfdisplayitem.rotate.html
                                • swfdisplayitem.rotateto.html
                                • swfdisplayitem.scale.html
                                • swfdisplayitem.scaleto.html
                                • swfdisplayitem.setdepth.html
                                • swfdisplayitem.setmasklevel.html
                                • swfdisplayitem.setmatrix.html
                                • swfdisplayitem.setname.html
                                • swfdisplayitem.setratio.html
                                • swfdisplayitem.skewx.html
                                • swfdisplayitem.skewxto.html
                                • swfdisplayitem.skewy.html
                                • swfdisplayitem.skewyto.html
                                • swffill.moveto.html
                                • swffill.rotateto.html
                                • swffill.scaleto.html
                                • swffill.skewxto.html
                                • swffill.skewyto.html
                                • swffont.construct.html
                                • swffont.getascent.html
                                • swffont.getdescent.html
                                • swffont.getleading.html
                                • swffont.getshape.html
                                • swffont.getutf8width.html
                                • swffont.getwidth.html
                                • swffontchar.addchars.html
                                • swffontchar.addutf8chars.html
                                • swfgradient.addentry.html
                                • swfgradient.construct.html
                                • swfmorph.construct.html
                                • swfmorph.getshape1.html
                                • swfmorph.getshape2.html
                                • swfmovie.add.html
                                • swfmovie.addexport.html
                                • swfmovie.addfont.html
                                • swfmovie.construct.html
                                • swfmovie.importchar.html
                                • swfmovie.importfont.html
                                • swfmovie.labelframe.html
                                • swfmovie.nextframe.html
                                • swfmovie.output.html
                                • swfmovie.remove.html
                                • swfmovie.save.html
                                • swfmovie.savetofile.html
                                • swfmovie.setbackground.html
                                • swfmovie.setdimension.html
                                • swfmovie.setframes.html
                                • swfmovie.setrate.html
                                • swfmovie.startsound.html
                                • swfmovie.stopsound.html
                                • swfmovie.streammp3.html
                                • swfmovie.writeexports.html
                                • swfprebuiltclip.construct.html
                                • swfshape.addfill.html
                                • swfshape.construct.html
                                • swfshape.drawarc.html
                                • swfshape.drawcircle.html
                                • swfshape.drawcubic.html
                                • swfshape.drawcubicto.html
                                • swfshape.drawcurve.html
                                • swfshape.drawcurveto.html
                                • swfshape.drawglyph.html
                                • swfshape.drawline.html
                                • swfshape.drawlineto.html
                                • swfshape.movepen.html
                                • swfshape.movepento.html
                                • swfshape.setleftfill.html
                                • swfshape.setline.html
                                • swfshape.setrightfill.html
                                • swfsound.construct.html
                                • swfsoundinstance.loopcount.html
                                • swfsoundinstance.loopinpoint.html
                                • swfsoundinstance.loopoutpoint.html
                                • swfsoundinstance.nomultiple.html
                                • swfsprite.add.html
                                • swfsprite.construct.html
                                • swfsprite.labelframe.html
                                • swfsprite.nextframe.html
                                • swfsprite.remove.html
                                • swfsprite.setframes.html
                                • swfsprite.startsound.html
                                • swfsprite.stopsound.html
                                • swftext.addstring.html
                                • swftext.addutf8string.html
                                • swftext.construct.html
                                • swftext.getascent.html
                                • swftext.getdescent.html
                                • swftext.getleading.html
                                • swftext.getutf8width.html
                                • swftext.getwidth.html
                                • swftext.moveto.html
                                • swftext.setcolor.html
                                • swftext.setfont.html
                                • swftext.setheight.html
                                • swftext.setspacing.html
                                • swftextfield.addchars.html
                                • swftextfield.addstring.html
                                • swftextfield.align.html
                                • swftextfield.construct.html
                                • swftextfield.setbounds.html
                                • swftextfield.setcolor.html
                                • swftextfield.setfont.html
                                • swftextfield.setheight.html
                                • swftextfield.setindentation.html
                                • swftextfield.setleftmargin.html
                                • swftextfield.setlinespacing.html
                                • swftextfield.setmargins.html
                                • swftextfield.setname.html
                                • swftextfield.setpadding.html
                                • swftextfield.setrightmargin.html
                                • swfvideostream.construct.html
                                • swfvideostream.getnumframes.html
                                • swfvideostream.setdimension.html
                                • swish.configuration.html
                                • swish.constants.html
                                • swish.construct.html
                                • swish.examples-basic.html
                                • swish.examples.html
                                • swish.getmetalist.html
                                • swish.getpropertylist.html
                                • swish.installation.html
                                • swish.prepare.html
                                • swish.query.html
                                • swish.requirements.html
                                • swish.resources.html
                                • swish.setup.html
                                • swishresult.getmetalist.html
                                • swishresult.stem.html
                                • swishresults.getparsedwords.html
                                • swishresults.getremovedstopwords.html
                                • swishresults.nextresult.html
                                • swishresults.seekresult.html
                                • swishsearch.execute.html
                                • swishsearch.resetlimit.html
                                • swishsearch.setlimit.html
                                • swishsearch.setphrasedelimiter.html
                                • swishsearch.setsort.html
                                • swishsearch.setstructure.html
                                • sybase.configuration.html
                                • sybase.constants.html
                                • sybase.installation.html
                                • sybase.requirements.html
                                • sybase.resources.html
                                • sybase.setup.html
                                • sync.configuration.html
                                • sync.constants.html
                                • sync.installation.html
                                • sync.requirements.html
                                • sync.resources.html
                                • sync.setup.html
                                • syncevent.construct.html
                                • syncevent.fire.html
                                • syncevent.reset.html
                                • syncevent.wait.html
                                • syncmutex.construct.html
                                • syncmutex.lock.html
                                • syncmutex.unlock.html
                                • syncreaderwriter.construct.html
                                • syncreaderwriter.readlock.html
                                • syncreaderwriter.readunlock.html
                                • syncreaderwriter.writelock.html
                                • syncreaderwriter.writeunlock.html
                                • syncsemaphore.construct.html
                                • syncsemaphore.lock.html
                                • syncsemaphore.unlock.html
                                • tag.getalbum.html
                                • tag.getartist.html
                                • tag.getcomment.html
                                • tag.getgenre.html
                                • tag.gettitle.html
                                • tag.gettrack.html
                                • tag.getyear.html
                                • tag.isempty.html
                                • taint.configuration.html
                                • taint.detail.basic.html
                                • taint.detail.html
                                • taint.detail.taint.html
                                • taint.detail.untaint.html
                                • taint.installation.html
                                • taint.requirements.html
                                • taint.resources.html
                                • taint.setup.html
                                • tcpwrap.configuration.html
                                • tcpwrap.constants.html
                                • tcpwrap.installation.html
                                • tcpwrap.requirements.html
                                • tcpwrap.resources.html
                                • tcpwrap.setup.html
                                • thread.detach.html
                                • thread.getcreatorid.html
                                • thread.getcurrentthread.html
                                • thread.getcurrentthreadid.html
                                • thread.getthreadid.html
                                • thread.globally.html
                                • thread.isjoined.html
                                • thread.isrunning.html
                                • thread.isstarted.html
                                • thread.join.html
                                • thread.kill.html
                                • thread.start.html
                                • threaded.chunk.html
                                • threaded.count.html
                                • threaded.extend.html
                                • threaded.from.html
                                • threaded.getterminationinfo.html
                                • threaded.isterminated.html
                                • threaded.iswaiting.html
                                • threaded.lock.html
                                • threaded.merge.html
                                • threaded.notify.html
                                • threaded.pop.html
                                • threaded.run.html
                                • threaded.shift.html
                                • threaded.synchronized.html
                                • threaded.unlock.html
                                • threaded.wait.html
                                • throwable.getcode.html
                                • throwable.getfile.html
                                • throwable.getline.html
                                • throwable.getmessage.html
                                • throwable.getprevious.html
                                • throwable.gettrace.html
                                • throwable.gettraceasstring.html
                                • throwable.tostring.html
                                • tidy.body.html
                                • tidy.cleanrepair.html
                                • tidy.configuration.html
                                • tidy.constants.html
                                • tidy.construct.html
                                • tidy.diagnose.html
                                • tidy.examples.basic.html
                                • tidy.examples.html
                                • tidy.getconfig.html
                                • tidy.gethtmlver.html
                                • tidy.getopt.html
                                • tidy.getoptdoc.html
                                • tidy.getrelease.html
                                • tidy.getstatus.html
                                • tidy.head.html
                                • tidy.html.html
                                • tidy.installation.html
                                • tidy.isxhtml.html
                                • tidy.isxml.html
                                • tidy.parsefile.html
                                • tidy.parsestring.html
                                • tidy.props.errorbuffer.html
                                • tidy.repairfile.html
                                • tidy.repairstring.html
                                • tidy.requirements.html
                                • tidy.resources.html
                                • tidy.root.html
                                • tidy.setup.html
                                • tidynode.getparent.html
                                • tidynode.haschildren.html
                                • tidynode.hassiblings.html
                                • tidynode.isasp.html
                                • tidynode.iscomment.html
                                • tidynode.ishtml.html
                                • tidynode.isjste.html
                                • tidynode.isphp.html
                                • tidynode.istext.html
                                • timezones.africa.html
                                • timezones.america.html
                                • timezones.antarctica.html
                                • timezones.arctic.html
                                • timezones.asia.html
                                • timezones.atlantic.html
                                • timezones.australia.html
                                • timezones.europe.html
                                • timezones.html
                                • timezones.indian.html
                                • timezones.others.html
                                • timezones.pacific.html
                                • tokenizer.configuration.html
                                • tokenizer.constants.html
                                • tokenizer.examples.html
                                • tokenizer.installation.html
                                • tokenizer.requirements.html
                                • tokenizer.resources.html
                                • tokenizer.setup.html
                                • tokens.html
                                • tokyo-tyrant.configuration.html
                                • tokyo-tyrant.constants.html
                                • tokyo-tyrant.examples.html
                                • tokyo-tyrant.installation.html
                                • tokyo-tyrant.requirements.html
                                • tokyo-tyrant.resources.html
                                • tokyo-tyrant.setup.html
                                • tokyotyrant.add.html
                                • tokyotyrant.connect.html
                                • tokyotyrant.connecturi.html
                                • tokyotyrant.construct.html
                                • tokyotyrant.copy.html
                                • tokyotyrant.ext.html
                                • tokyotyrant.fwmkeys.html
                                • tokyotyrant.get.html
                                • tokyotyrant.getiterator.html
                                • tokyotyrant.num.html
                                • tokyotyrant.out.html
                                • tokyotyrant.put.html
                                • tokyotyrant.putcat.html
                                • tokyotyrant.putkeep.html
                                • tokyotyrant.putnr.html
                                • tokyotyrant.putshl.html
                                • tokyotyrant.restore.html
                                • tokyotyrant.setmaster.html
                                • tokyotyrant.size.html
                                • tokyotyrant.stat.html
                                • tokyotyrant.sync.html
                                • tokyotyrant.tune.html
                                • tokyotyrant.vanish.html
                                • tokyotyrantiterator.construct.html
                                • tokyotyrantiterator.current.html
                                • tokyotyrantiterator.key.html
                                • tokyotyrantiterator.next.html
                                • tokyotyrantiterator.rewind.html
                                • tokyotyrantiterator.valid.html
                                • tokyotyrantquery.addcond.html
                                • tokyotyrantquery.construct.html
                                • tokyotyrantquery.count.html
                                • tokyotyrantquery.current.html
                                • tokyotyrantquery.hint.html
                                • tokyotyrantquery.key.html
                                • tokyotyrantquery.metasearch.html
                                • tokyotyrantquery.next.html
                                • tokyotyrantquery.out.html
                                • tokyotyrantquery.rewind.html
                                • tokyotyrantquery.search.html
                                • tokyotyrantquery.setlimit.html
                                • tokyotyrantquery.setorder.html
                                • tokyotyrantquery.valid.html
                                • tokyotyranttable.add.html
                                • tokyotyranttable.genuid.html
                                • tokyotyranttable.get.html
                                • tokyotyranttable.getiterator.html
                                • tokyotyranttable.getquery.html
                                • tokyotyranttable.out.html
                                • tokyotyranttable.put.html
                                • tokyotyranttable.putcat.html
                                • tokyotyranttable.putkeep.html
                                • tokyotyranttable.putnr.html
                                • tokyotyranttable.putshl.html
                                • tokyotyranttable.setindex.html
                                • trader.configuration.html
                                • trader.constants.html
                                • trader.installation.html
                                • trader.requirements.html
                                • trader.setup.html
                                • transliterator.construct.html
                                • transliterator.create.html
                                • transliterator.createfromrules.html
                                • transliterator.createinverse.html
                                • transliterator.geterrorcode.html
                                • transliterator.geterrormessage.html
                                • transliterator.listids.html
                                • transliterator.transliterate.html
                                • transports.html
                                • transports.inet.html
                                • transports.unix.html
                                • tutorial.firstpage.html
                                • tutorial.forms.html
                                • tutorial.html
                                • tutorial.oldcode.html
                                • tutorial.requirements.html
                                • tutorial.useful.html
                                • tutorial.whatsnext.html
                                • types.comparisons.html
                                • uconverter.construct.html
                                • uconverter.convert.html
                                • uconverter.fromucallback.html
                                • uconverter.getaliases.html
                                • uconverter.getavailable.html
                                • uconverter.getdestinationencoding.html
                                • uconverter.getdestinationtype.html
                                • uconverter.geterrorcode.html
                                • uconverter.geterrormessage.html
                                • uconverter.getsourceencoding.html
                                • uconverter.getsourcetype.html
                                • uconverter.getstandards.html
                                • uconverter.getsubstchars.html
                                • uconverter.reasontext.html
                                • uconverter.setdestinationencoding.html
                                • uconverter.setsourceencoding.html
                                • uconverter.setsubstchars.html
                                • uconverter.toucallback.html
                                • uconverter.transcode.html
                                • uodbc.constants.html
                                • uodbc.requirements.html
                                • uodbc.resources.html
                                • uodbc.setup.html
                                • uopz.configuration.html
                                • uopz.constants.html
                                • uopz.installation.html
                                • uopz.requirements.html
                                • uopz.resources.html
                                • uopz.setup.html
                                • url.configuration.html
                                • url.constants.html
                                • url.installation.html
                                • url.requirements.html
                                • url.resources.html
                                • url.setup.html
                                • userlandnaming.globalnamespace.html
                                • userlandnaming.html
                                • userlandnaming.rules.html
                                • userlandnaming.tips.html
                                • v8js.configuration.html
                                • v8js.construct.html
                                • v8js.examples.html
                                • v8js.executestring.html
                                • v8js.getextensions.html
                                • v8js.getpendingexception.html
                                • v8js.installation.html
                                • v8js.registerextension.html
                                • v8js.requirements.html
                                • v8js.resources.html
                                • v8js.setup.html
                                • v8jsexception.getjsfilename.html
                                • v8jsexception.getjslinenumber.html
                                • v8jsexception.getjssourceline.html
                                • v8jsexception.getjstrace.html
                                • var.configuration.html
                                • var.constants.html
                                • var.installation.html
                                • var.requirements.html
                                • var.resources.html
                                • var.setup.html
                                • varnish.configuration.html
                                • varnish.constants.html
                                • varnish.example.admin.html
                                • varnish.example.log.html
                                • varnish.example.stat.html
                                • varnish.examples.html
                                • varnish.installation.html
                                • varnish.requirements.html
                                • varnish.resources.html
                                • varnish.setup.html
                                • varnishadmin.auth.html
                                • varnishadmin.ban.html
                                • varnishadmin.banurl.html
                                • varnishadmin.clearpanic.html
                                • varnishadmin.connect.html
                                • varnishadmin.construct.html
                                • varnishadmin.disconnect.html
                                • varnishadmin.getpanic.html
                                • varnishadmin.getparams.html
                                • varnishadmin.isrunning.html
                                • varnishadmin.setcompat.html
                                • varnishadmin.sethost.html
                                • varnishadmin.setident.html
                                • varnishadmin.setparam.html
                                • varnishadmin.setport.html
                                • varnishadmin.setsecret.html
                                • varnishadmin.settimeout.html
                                • varnishadmin.start.html
                                • varnishadmin.stop.html
                                • varnishlog.construct.html
                                • varnishlog.getline.html
                                • varnishlog.gettagname.html
                                • varnishstat.construct.html
                                • varnishstat.getsnapshot.html
                                • vpopmail.configuration.html
                                • vpopmail.constants.html
                                • vpopmail.installation.html
                                • vpopmail.requirements.html
                                • vpopmail.resources.html
                                • vpopmail.setup.html
                                • wddx.configuration.html
                                • wddx.constants.html
                                • wddx.examples-serialize.html
                                • wddx.examples.html
                                • wddx.installation.html
                                • wddx.requirements.html
                                • wddx.resources.html
                                • wddx.setup.html
                                • weakmap.construct.html
                                • weakmap.count.html
                                • weakmap.current.html
                                • weakmap.key.html
                                • weakmap.next.html
                                • weakmap.offsetexists.html
                                • weakmap.offsetget.html
                                • weakmap.offsetset.html
                                • weakmap.offsetunset.html
                                • weakmap.rewind.html
                                • weakmap.valid.html
                                • weakref.acquire.html
                                • weakref.construct.html
                                • weakref.get.html
                                • weakref.installation.html
                                • weakref.release.html
                                • weakref.requirements.html
                                • weakref.resources.html
                                • weakref.setup.html
                                • weakref.valid.html
                                • win32ps.configuration.html
                                • win32ps.constants.html
                                • win32ps.examples-process.html
                                • win32ps.examples.html
                                • win32ps.installation.html
                                • win32ps.requirements.html
                                • win32ps.resources.html
                                • win32ps.setup.html
                                • win32service.configuration.html
                                • win32service.constants.basepriorities.html
                                • win32service.constants.controlsaccepted.html
                                • win32service.constants.errorcontrol.html
                                • win32service.constants.errors.html
                                • win32service.constants.html
                                • win32service.constants.servicecontrol.html
                                • win32service.constants.serviceflag.html
                                • win32service.constants.servicestarttype.html
                                • win32service.constants.servicestatus.html
                                • win32service.constants.servicetype.html
                                • win32service.examples.html
                                • win32service.installation.html
                                • win32service.requirements.html
                                • win32service.resources.html
                                • win32service.setup.html
                                • wincache.configuration.html
                                • wincache.constants.html
                                • wincache.installation.html
                                • wincache.requirements.html
                                • wincache.reroutes.html
                                • wincache.resources.html
                                • wincache.sessionhandler.html
                                • wincache.setup.html
                                • wincache.stats.html
                                • wincache.win32build.building.html
                                • wincache.win32build.html
                                • wincache.win32build.prereq.html
                                • wincache.win32build.verify.html
                                • worker.getstacked.html
                                • worker.isshutdown.html
                                • worker.isworking.html
                                • worker.shutdown.html
                                • worker.stack.html
                                • worker.unstack.html
                                • wrappers.audio.html
                                • wrappers.compression.html
                                • wrappers.data.html
                                • wrappers.expect.html
                                • wrappers.file.html
                                • wrappers.ftp.html
                                • wrappers.glob.html
                                • wrappers.html
                                • wrappers.http.html
                                • wrappers.phar.html
                                • wrappers.php.html
                                • wrappers.rar.html
                                • wrappers.ssh2.html
                                • xattr.configuration.html
                                • xattr.constants.html
                                • xattr.installation.html
                                • xattr.requirements.html
                                • xattr.resources.html
                                • xattr.setup.html
                                • xdiff.configuration.html
                                • xdiff.constants.html
                                • xdiff.installation.html
                                • xdiff.requirements.html
                                • xdiff.resources.html
                                • xdiff.setup.html
                                • xhprof.configuration.html
                                • xhprof.constants.html
                                • xhprof.examples.html
                                • xhprof.installation.html
                                • xhprof.requirements.html
                                • xhprof.resources.html
                                • xhprof.setup.html
                                • xml.case-folding.html
                                • xml.configuration.html
                                • xml.constants.html
                                • xml.encoding.html
                                • xml.error-codes.html
                                • xml.eventhandlers.html
                                • xml.examples.html
                                • xml.installation.html
                                • xml.requirements.html
                                • xml.resources.html
                                • xml.setup.html
                                • xmldiff-base.construct.html
                                • xmldiff-base.diff.html
                                • xmldiff-base.merge.html
                                • xmldiff-dom.diff.html
                                • xmldiff-dom.merge.html
                                • xmldiff-file.diff.html
                                • xmldiff-file.merge.html
                                • xmldiff-memory.diff.html
                                • xmldiff-memory.merge.html
                                • xmldiff.installation.html
                                • xmldiff.requirements.html
                                • xmldiff.setup.html
                                • xmlreader.close.html
                                • xmlreader.configuration.html
                                • xmlreader.expand.html
                                • xmlreader.getattribute.html
                                • xmlreader.getattributeno.html
                                • xmlreader.getattributens.html
                                • xmlreader.getparserproperty.html
                                • xmlreader.installation.html
                                • xmlreader.isvalid.html
                                • xmlreader.lookupnamespace.html
                                • xmlreader.movetoattribute.html
                                • xmlreader.movetoattributeno.html
                                • xmlreader.movetoattributens.html
                                • xmlreader.movetoelement.html
                                • xmlreader.movetofirstattribute.html
                                • xmlreader.movetonextattribute.html
                                • xmlreader.next.html
                                • xmlreader.open.html
                                • xmlreader.read.html
                                • xmlreader.readinnerxml.html
                                • xmlreader.readouterxml.html
                                • xmlreader.readstring.html
                                • xmlreader.requirements.html
                                • xmlreader.resources.html
                                • xmlreader.setparserproperty.html
                                • xmlreader.setrelaxngschema.html
                                • xmlreader.setrelaxngschemasource.html
                                • xmlreader.setschema.html
                                • xmlreader.setup.html
                                • xmlreader.xml.html
                                • xmlrpc.configuration.html
                                • xmlrpc.constants.html
                                • xmlrpc.installation.html
                                • xmlrpc.requirements.html
                                • xmlrpc.resources.html
                                • xmlrpc.setup.html
                                • xmlwriter.configuration.html
                                • xmlwriter.constants.html
                                • xmlwriter.installation.html
                                • xmlwriter.requirements.html
                                • xmlwriter.resources.html
                                • xmlwriter.setup.html
                                • xsl.configuration.html
                                • xsl.constants.html
                                • xsl.examples-collection.html
                                • xsl.examples-errors.html
                                • xsl.examples.html
                                • xsl.installation.html
                                • xsl.requirements.html
                                • xsl.resources.html
                                • xsl.setup.html
                                • xsltprocessor.construct.html
                                • xsltprocessor.getparameter.html
                                • xsltprocessor.getsecurityprefs.html
                                • xsltprocessor.hasexsltsupport.html
                                • xsltprocessor.importstylesheet.html
                                • xsltprocessor.registerphpfunctions.html
                                • xsltprocessor.removeparameter.html
                                • xsltprocessor.setparameter.html
                                • xsltprocessor.setprofiling.html
                                • xsltprocessor.setsecurityprefs.html
                                • xsltprocessor.transformtodoc.html
                                • xsltprocessor.transformtouri.html
                                • xsltprocessor.transformtoxml.html
                                • yaf-action-abstract.execute.html
                                • yaf-action-abstract.getcontroller.html
                                • yaf-application.app.html
                                • yaf-application.bootstrap.html
                                • yaf-application.clearlasterror.html
                                • yaf-application.clone.html
                                • yaf-application.construct.html
                                • yaf-application.destruct.html
                                • yaf-application.environ.html
                                • yaf-application.execute.html
                                • yaf-application.getappdirectory.html
                                • yaf-application.getconfig.html
                                • yaf-application.getdispatcher.html
                                • yaf-application.getlasterrormsg.html
                                • yaf-application.getlasterrorno.html
                                • yaf-application.getmodules.html
                                • yaf-application.run.html
                                • yaf-application.setappdirectory.html
                                • yaf-application.sleep.html
                                • yaf-application.wakeup.html
                                • yaf-config-abstract.get.html
                                • yaf-config-abstract.readonly.html
                                • yaf-config-abstract.set.html
                                • yaf-config-abstract.toarray.html
                                • yaf-config-ini.construct.html
                                • yaf-config-ini.count.html
                                • yaf-config-ini.current.html
                                • yaf-config-ini.get.html
                                • yaf-config-ini.isset.html
                                • yaf-config-ini.key.html
                                • yaf-config-ini.next.html
                                • yaf-config-ini.offsetexists.html
                                • yaf-config-ini.offsetget.html
                                • yaf-config-ini.offsetset.html
                                • yaf-config-ini.offsetunset.html
                                • yaf-config-ini.readonly.html
                                • yaf-config-ini.rewind.html
                                • yaf-config-ini.set.html
                                • yaf-config-ini.toarray.html
                                • yaf-config-ini.valid.html
                                • yaf-config-simple.construct.html
                                • yaf-config-simple.count.html
                                • yaf-config-simple.current.html
                                • yaf-config-simple.get.html
                                • yaf-config-simple.isset.html
                                • yaf-config-simple.key.html
                                • yaf-config-simple.next.html
                                • yaf-config-simple.offsetexists.html
                                • yaf-config-simple.offsetget.html
                                • yaf-config-simple.offsetset.html
                                • yaf-config-simple.offsetunset.html
                                • yaf-config-simple.readonly.html
                                • yaf-config-simple.rewind.html
                                • yaf-config-simple.set.html
                                • yaf-config-simple.toarray.html
                                • yaf-config-simple.valid.html
                                • yaf-controller-abstract.clone.html
                                • yaf-controller-abstract.construct.html
                                • yaf-controller-abstract.display.html
                                • yaf-controller-abstract.forward.html
                                • yaf-controller-abstract.getinvokearg.html
                                • yaf-controller-abstract.getinvokeargs.html
                                • yaf-controller-abstract.getmodulename.html
                                • yaf-controller-abstract.getrequest.html
                                • yaf-controller-abstract.getresponse.html
                                • yaf-controller-abstract.getview.html
                                • yaf-controller-abstract.getviewpath.html
                                • yaf-controller-abstract.init.html
                                • yaf-controller-abstract.initview.html
                                • yaf-controller-abstract.redirect.html
                                • yaf-controller-abstract.render.html
                                • yaf-controller-abstract.setviewpath.html
                                • yaf-dispatcher.autorender.html
                                • yaf-dispatcher.catchexception.html
                                • yaf-dispatcher.clone.html
                                • yaf-dispatcher.construct.html
                                • yaf-dispatcher.disableview.html
                                • yaf-dispatcher.dispatch.html
                                • yaf-dispatcher.enableview.html
                                • yaf-dispatcher.flushinstantly.html
                                • yaf-dispatcher.getapplication.html
                                • yaf-dispatcher.getinstance.html
                                • yaf-dispatcher.getrequest.html
                                • yaf-dispatcher.getrouter.html
                                • yaf-dispatcher.initview.html
                                • yaf-dispatcher.registerplugin.html
                                • yaf-dispatcher.returnresponse.html
                                • yaf-dispatcher.setdefaultaction.html
                                • yaf-dispatcher.setdefaultcontroller.html
                                • yaf-dispatcher.setdefaultmodule.html
                                • yaf-dispatcher.seterrorhandler.html
                                • yaf-dispatcher.setrequest.html
                                • yaf-dispatcher.setview.html
                                • yaf-dispatcher.sleep.html
                                • yaf-dispatcher.throwexception.html
                                • yaf-dispatcher.wakeup.html
                                • yaf-exception.construct.html
                                • yaf-exception.getprevious.html
                                • yaf-loader.autoload.html
                                • yaf-loader.clearlocalnamespace.html
                                • yaf-loader.clone.html
                                • yaf-loader.construct.html
                                • yaf-loader.getinstance.html
                                • yaf-loader.getlibrarypath.html
                                • yaf-loader.getlocalnamespace.html
                                • yaf-loader.import.html
                                • yaf-loader.islocalname.html
                                • yaf-loader.registerlocalnamespace.html
                                • yaf-loader.setlibrarypath.html
                                • yaf-loader.sleep.html
                                • yaf-loader.wakeup.html
                                • yaf-plugin-abstract.dispatchloopshutdown.html
                                • yaf-plugin-abstract.dispatchloopstartup.html
                                • yaf-plugin-abstract.postdispatch.html
                                • yaf-plugin-abstract.predispatch.html
                                • yaf-plugin-abstract.preresponse.html
                                • yaf-plugin-abstract.routershutdown.html
                                • yaf-plugin-abstract.routerstartup.html
                                • yaf-registry.clone.html
                                • yaf-registry.construct.html
                                • yaf-registry.del.html
                                • yaf-registry.get.html
                                • yaf-registry.has.html
                                • yaf-registry.set.html
                                • yaf-request-abstract.getactionname.html
                                • yaf-request-abstract.getbaseuri.html
                                • yaf-request-abstract.getcontrollername.html
                                • yaf-request-abstract.getenv.html
                                • yaf-request-abstract.getexception.html
                                • yaf-request-abstract.getlanguage.html
                                • yaf-request-abstract.getmethod.html
                                • yaf-request-abstract.getmodulename.html
                                • yaf-request-abstract.getparam.html
                                • yaf-request-abstract.getparams.html
                                • yaf-request-abstract.getrequesturi.html
                                • yaf-request-abstract.getserver.html
                                • yaf-request-abstract.iscli.html
                                • yaf-request-abstract.isdispatched.html
                                • yaf-request-abstract.isget.html
                                • yaf-request-abstract.ishead.html
                                • yaf-request-abstract.isoptions.html
                                • yaf-request-abstract.ispost.html
                                • yaf-request-abstract.isput.html
                                • yaf-request-abstract.isrouted.html
                                • yaf-request-abstract.isxmlhttprequest.html
                                • yaf-request-abstract.setactionname.html
                                • yaf-request-abstract.setbaseuri.html
                                • yaf-request-abstract.setcontrollername.html
                                • yaf-request-abstract.setdispatched.html
                                • yaf-request-abstract.setmodulename.html
                                • yaf-request-abstract.setparam.html
                                • yaf-request-abstract.setrequesturi.html
                                • yaf-request-abstract.setrouted.html
                                • yaf-request-http.clone.html
                                • yaf-request-http.construct.html
                                • yaf-request-http.get.html
                                • yaf-request-http.getcookie.html
                                • yaf-request-http.getfiles.html
                                • yaf-request-http.getpost.html
                                • yaf-request-http.getquery.html
                                • yaf-request-http.getrequest.html
                                • yaf-request-http.isxmlhttprequest.html
                                • yaf-request-simple.clone.html
                                • yaf-request-simple.construct.html
                                • yaf-request-simple.get.html
                                • yaf-request-simple.getcookie.html
                                • yaf-request-simple.getfiles.html
                                • yaf-request-simple.getpost.html
                                • yaf-request-simple.getquery.html
                                • yaf-request-simple.getrequest.html
                                • yaf-request-simple.isxmlhttprequest.html
                                • yaf-response-abstract.appendbody.html
                                • yaf-response-abstract.clearbody.html
                                • yaf-response-abstract.clearheaders.html
                                • yaf-response-abstract.clone.html
                                • yaf-response-abstract.construct.html
                                • yaf-response-abstract.destruct.html
                                • yaf-response-abstract.getbody.html
                                • yaf-response-abstract.getheader.html
                                • yaf-response-abstract.prependbody.html
                                • yaf-response-abstract.response.html
                                • yaf-response-abstract.setallheaders.html
                                • yaf-response-abstract.setbody.html
                                • yaf-response-abstract.setheader.html
                                • yaf-response-abstract.setredirect.html
                                • yaf-response-abstract.tostring.html
                                • yaf-route-interface.assemble.html
                                • yaf-route-interface.route.html
                                • yaf-route-map.assemble.html
                                • yaf-route-map.construct.html
                                • yaf-route-map.route.html
                                • yaf-route-regex.assemble.html
                                • yaf-route-regex.construct.html
                                • yaf-route-regex.route.html
                                • yaf-route-rewrite.assemble.html
                                • yaf-route-rewrite.construct.html
                                • yaf-route-rewrite.route.html
                                • yaf-route-simple.assemble.html
                                • yaf-route-simple.construct.html
                                • yaf-route-simple.route.html
                                • yaf-route-static.assemble.html
                                • yaf-route-static.match.html
                                • yaf-route-static.route.html
                                • yaf-route-supervar.assemble.html
                                • yaf-route-supervar.construct.html
                                • yaf-route-supervar.route.html
                                • yaf-router.addconfig.html
                                • yaf-router.addroute.html
                                • yaf-router.construct.html
                                • yaf-router.getcurrentroute.html
                                • yaf-router.getroute.html
                                • yaf-router.getroutes.html
                                • yaf-router.route.html
                                • yaf-session.clone.html
                                • yaf-session.construct.html
                                • yaf-session.count.html
                                • yaf-session.current.html
                                • yaf-session.del.html
                                • yaf-session.get.html
                                • yaf-session.getinstance.html
                                • yaf-session.has.html
                                • yaf-session.isset.html
                                • yaf-session.key.html
                                • yaf-session.next.html
                                • yaf-session.offsetexists.html
                                • yaf-session.offsetget.html
                                • yaf-session.offsetset.html
                                • yaf-session.offsetunset.html
                                • yaf-session.rewind.html
                                • yaf-session.set.html
                                • yaf-session.sleep.html
                                • yaf-session.start.html
                                • yaf-session.unset.html
                                • yaf-session.valid.html
                                • yaf-session.wakeup.html
                                • yaf-view-interface.assign.html
                                • yaf-view-interface.display.html
                                • yaf-view-interface.getscriptpath.html
                                • yaf-view-interface.render.html
                                • yaf-view-interface.setscriptpath.html
                                • yaf-view-simple.assign.html
                                • yaf-view-simple.assignref.html
                                • yaf-view-simple.clear.html
                                • yaf-view-simple.construct.html
                                • yaf-view-simple.display.html
                                • yaf-view-simple.eval.html
                                • yaf-view-simple.get.html
                                • yaf-view-simple.getscriptpath.html
                                • yaf-view-simple.isset.html
                                • yaf-view-simple.render.html
                                • yaf-view-simple.set.html
                                • yaf-view-simple.setscriptpath.html
                                • yaf.appconfig.html
                                • yaf.configuration.html
                                • yaf.constants.html
                                • yaf.installation.html
                                • yaf.requirements.html
                                • yaf.resources.html
                                • yaf.setup.html
                                • yaf.tutorials.html
                                • yaml.callbacks.emit.html
                                • yaml.callbacks.html
                                • yaml.callbacks.parse.html
                                • yaml.configuration.html
                                • yaml.constants.html
                                • yaml.examples.html
                                • yaml.installation.html
                                • yaml.requirements.html
                                • yaml.resources.html
                                • yaml.setup.html
                                • yar-client-exception.gettype.html
                                • yar-client.call.html
                                • yar-client.construct.html
                                • yar-client.setopt.html
                                • yar-concurrent-client.call.html
                                • yar-concurrent-client.loop.html
                                • yar-concurrent-client.reset.html
                                • yar-server-exception.gettype.html
                                • yar-server.construct.html
                                • yar-server.handle.html
                                • yar.configuration.html
                                • yar.constants.html
                                • yar.examples.html
                                • yar.installation.html
                                • yar.requirements.html
                                • yar.resources.html
                                • yar.setup.html
                                • yaz.configuration.html
                                • yaz.constants.html
                                • yaz.examples.html
                                • yaz.installation.html
                                • yaz.requirements.html
                                • yaz.resources.html
                                • yaz.setup.html
                                • zip.configuration.html
                                • zip.constants.html
                                • zip.examples.html
                                • zip.installation.html
                                • zip.requirements.html
                                • zip.resources.html
                                • zip.setup.html
                                • ziparchive.addemptydir.html
                                • ziparchive.addfile.html
                                • ziparchive.addfromstring.html
                                • ziparchive.addglob.html
                                • ziparchive.addpattern.html
                                • ziparchive.close.html
                                • ziparchive.deleteindex.html
                                • ziparchive.deletename.html
                                • ziparchive.extractto.html
                                • ziparchive.getarchivecomment.html
                                • ziparchive.getcommentindex.html
                                • ziparchive.getcommentname.html
                                • ziparchive.getexternalattributesindex.html
                                • ziparchive.getexternalattributesname.html
                                • ziparchive.getfromindex.html
                                • ziparchive.getfromname.html
                                • ziparchive.getnameindex.html
                                • ziparchive.getstatusstring.html
                                • ziparchive.getstream.html
                                • ziparchive.locatename.html
                                • ziparchive.open.html
                                • ziparchive.renameindex.html
                                • ziparchive.renamename.html
                                • ziparchive.setarchivecomment.html
                                • ziparchive.setcommentindex.html
                                • ziparchive.setcommentname.html
                                • ziparchive.setcompressionindex.html
                                • ziparchive.setcompressionname.html
                                • ziparchive.setexternalattributesindex.html
                                • ziparchive.setexternalattributesname.html
                                • ziparchive.setpassword.html
                                • ziparchive.statindex.html
                                • ziparchive.statname.html
                                • ziparchive.unchangeall.html
                                • ziparchive.unchangearchive.html
                                • ziparchive.unchangeindex.html
                                • ziparchive.unchangename.html
                                • zlib.configuration.html
                                • zlib.constants.html
                                • zlib.examples.html
                                • zlib.installation.html
                                • zlib.requirements.html
                                • zlib.resources.html
                                • zlib.setup.html
                                • zmq.construct.html
                                • zmq.requirements.html
                                • zmq.setup.html
                                • zmqcontext.construct.html
                                • zmqcontext.getopt.html
                                • zmqcontext.getsocket.html
                                • zmqcontext.ispersistent.html
                                • zmqcontext.setopt.html
                                • zmqdevice.construct.html
                                • zmqdevice.getidletimeout.html
                                • zmqdevice.gettimertimeout.html
                                • zmqdevice.run.html
                                • zmqdevice.setidlecallback.html
                                • zmqdevice.setidletimeout.html
                                • zmqdevice.settimercallback.html
                                • zmqdevice.settimertimeout.html
                                • zmqpoll.add.html
                                • zmqpoll.clear.html
                                • zmqpoll.count.html
                                • zmqpoll.getlasterrors.html
                                • zmqpoll.poll.html
                                • zmqpoll.remove.html
                                • zmqsocket.bind.html
                                • zmqsocket.connect.html
                                • zmqsocket.construct.html
                                • zmqsocket.disconnect.html
                                • zmqsocket.getendpoints.html
                                • zmqsocket.getpersistentid.html
                                • zmqsocket.getsockettype.html
                                • zmqsocket.getsockopt.html
                                • zmqsocket.ispersistent.html
                                • zmqsocket.recv.html
                                • zmqsocket.recvmulti.html
                                • zmqsocket.send.html
                                • zmqsocket.sendmulti.html
                                • zmqsocket.setsockopt.html
                                • zmqsocket.unbind.html