
Name qt5-doc
Version 5.7.1-1
Beschreibung A cross-platform application and UI framework (Documentation)
URL http://qt-project.org/
Lizenzen GPL3, LGPL3, FDL, custom
Repositorium extra
Architektur any
Gruppen qt, qt5
Packer Antonio Rojas @
Erstellt am 14.12.2016 10:30
Veröffentlicht am 17.12.2016 10:53
Quelltext Quelldateien, Änderungshistorie
Bugs Bug-Tracker
Paket qt5-doc-5.7.1-1-any.pkg.tar.xz
MD5-Prüfsumme 2d677b50698a29d29129e1922128ec98
SHA256-Prüfsumme 6ce0c724fa7cd246e721089ca5e70af85ff149a0097e9aadf8ce2f4664fa43f0
PGP-Signatur qt5-doc-5.7.1-1-any.pkg.tar.xz.sig
Paket-Größe 193,74 MByte
Installations-Größe 476,89 MByte
hängt ab von benötigt von stellt bereit kollidiert mit ersetzt
        hängt optional ab von optional benötigt von Bauen hängt ab von Bauen benötigt von Test hängt ab von
            • usr
              • share
                • doc
                  • qt
                    • activeqt.qch
                    • activeqt
                      • activeqt-activeqt-comapp-comapp-pro.html
                      • activeqt-activeqt-comapp-example.html
                      • activeqt-activeqt-comapp-main-cpp.html
                      • activeqt-activeqt-hierarchy-example.html
                      • activeqt-activeqt-hierarchy-hierarchy-pro.html
                      • activeqt-activeqt-hierarchy-main-cpp.html
                      • activeqt-activeqt-hierarchy-objects-cpp.html
                      • activeqt-activeqt-hierarchy-objects-h.html
                      • activeqt-activeqt-menus-example.html
                      • activeqt-activeqt-menus-main-cpp.html
                      • activeqt-activeqt-menus-menus-cpp.html
                      • activeqt-activeqt-menus-menus-h.html
                      • activeqt-activeqt-menus-menus-pro.html
                      • activeqt-activeqt-multiple-ax1-h.html
                      • activeqt-activeqt-multiple-ax2-h.html
                      • activeqt-activeqt-multiple-example.html
                      • activeqt-activeqt-multiple-main-cpp.html
                      • activeqt-activeqt-multiple-multiple-pro.html
                      • activeqt-activeqt-opengl-example.html
                      • activeqt-activeqt-opengl-glbox-cpp.html
                      • activeqt-activeqt-opengl-glbox-h.html
                      • activeqt-activeqt-opengl-globjwin-cpp.html
                      • activeqt-activeqt-opengl-globjwin-h.html
                      • activeqt-activeqt-opengl-main-cpp.html
                      • activeqt-activeqt-opengl-opengl-pro.html
                      • activeqt-activeqt-qutlook-addressview-cpp.html
                      • activeqt-activeqt-qutlook-addressview-h.html
                      • activeqt-activeqt-qutlook-example.html
                      • activeqt-activeqt-qutlook-main-cpp.html
                      • activeqt-activeqt-qutlook-qutlook-pro.html
                      • activeqt-activeqt-simple-example.html
                      • activeqt-activeqt-simple-main-cpp.html
                      • activeqt-activeqt-simple-simple-pro.html
                      • activeqt-activeqt-webbrowser-example.html
                      • activeqt-activeqt-webbrowser-main-cpp.html
                      • activeqt-activeqt-webbrowser-mainwindow-ui.html
                      • activeqt-activeqt-webbrowser-webaxwidget-h.html
                      • activeqt-activeqt-webbrowser-webbrowser-pro.html
                      • activeqt-activeqt-wrapper-example.html
                      • activeqt-activeqt-wrapper-main-cpp.html
                      • activeqt-activeqt-wrapper-wrapper-pro.html
                      • activeqt-container.html
                      • activeqt-dotnet.html
                      • activeqt-dumpcpp.html
                      • activeqt-dumpdoc.html
                      • activeqt-index.html
                      • activeqt-server.html
                      • activeqt-tools.html
                      • activeqt.index
                      • activeqt.qhp
                      • activeqt.qhp.sha1
                      • activeqt.tags
                      • examples-manifest.xml
                      • images
                        • activeqt-webbrowser-example.png
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                      • qaxaggregated-members.html
                      • qaxaggregated.html
                      • qaxbase-members.html
                      • qaxbase.html
                      • qaxbindable-members.html
                      • qaxbindable.html
                      • qaxcontainer-module.html
                      • qaxfactory-members.html
                      • qaxfactory.html
                      • qaxobject-members.html
                      • qaxobject.html
                      • qaxscript-members.html
                      • qaxscript.html
                      • qaxscriptengine-members.html
                      • qaxscriptengine.html
                      • qaxscriptmanager-members.html
                      • qaxscriptmanager.html
                      • qaxselect-members.html
                      • qaxselect.html
                      • qaxserver-demo-hierarchy.html
                      • qaxserver-demo-menus.html
                      • qaxserver-demo-multiple.html
                      • qaxserver-demo-opengl.html
                      • qaxserver-demo-simple.html
                      • qaxserver-demo-wrapper.html
                      • qaxserver-module.html
                      • qaxwidget-members.html
                      • qaxwidget.html
                      • style
                        • offline-simple.css
                        • offline.css
                    • qdoc.qch
                    • qdoc
                      • 01-qdoc-manual.html
                      • 03-qdoc-commands-markup.html
                      • 04-qdoc-commands-textmarkup.html
                      • 05-qdoc-commands-documentstructure.html
                      • 06-qdoc-commands-includecodeinline.html
                      • 07-0-qdoc-commands-includingexternalcode.html
                      • 08-qdoc-commands-creatinglinks.html
                      • 09-qdoc-commands-includingimages.html
                      • 10-qdoc-commands-tablesandlists.html
                      • 11-qdoc-commands-specialcontent.html
                      • 12-0-qdoc-commands-miscellaneous.html
                      • 13-qdoc-commands-topics.html
                      • 14-qdoc-commands-contextcommands.html
                      • 15-qdoc-commands-navigation.html
                      • 16-qdoc-commands-status.html
                      • 17-qdoc-commands-thread.html
                      • 18-qdoc-commands-relating.html
                      • 19-qdoc-commands-grouping.html
                      • 20-qdoc-commands-namingthings.html
                      • 21-0-qdoc-configuration.html
                      • 21-0-qdoc-creating-dita-maps.html
                      • 21-1-minimum-qdocconf.html
                      • 21-2-qtgui-qdocconf.html
                      • 21-3-qt-dita-xml-output.html
                      • 22-creating-help-project-files.html
                      • 22-qdoc-configuration-generalvariables.html
                      • 23-qdoc-configuration-cppvariables.html
                      • 24-qdoc-configuration-htmlvariables.html
                      • 25-qdoc-configuration-derivedprojects.html
                      • 26-qdoc-configuration-example-manifest-files.html
                      • 27-qdoc-commands-alphabetical.html
                      • 28-qdoc-qa-pages.html
                      • corefeatures.html
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • happy.gif
                        • happyguy.jpg
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • link-to-qquickitem.png
                        • links-to-links.png
                        • logo.png
                        • qa-table.png
                        • training.jpg
                        • windowsvista-pushbutton.png
                        • windowsvista-toolbutton.png
                      • qdoc-categories.html
                      • qdoc-componentset-componentset-pro.html
                      • qdoc-componentset-example.html
                      • qdoc-componentset-progressbar-qml.html
                      • qdoc-componentset-switch-qml.html
                      • qdoc-componentset-tabwidget-qml.html
                      • qdoc-componentset-uicomponents-qdoc-sample.html
                      • qdoc-guide-conf.html
                      • qdoc-guide-writing.html
                      • qdoc-guide.html
                      • qdoc-index.html
                      • qdoc-minimum-qdocconf.html
                      • qdoc.index
                      • qdoc.qhp
                      • qdoc.qhp.sha1
                      • qdoc.tags
                      • qml-uicomponents-progressbar-members.html
                      • qml-uicomponents-progressbar.html
                      • qml-uicomponents-switch-members.html
                      • qml-uicomponents-switch.html
                      • qml-uicomponents-tabwidget-members.html
                      • qml-uicomponents-tabwidget.html
                      • qtgui-qdocconf.html
                      • qtwritingstyle-cpp.html
                      • qtwritingstyle-qml.html
                      • style
                        • offline-simple.css
                        • offline.css
                      • uicomponents-qmlmodule.html
                    • qmake.qch
                    • qmake
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • qmake-precompile-ui.png
                      • qmake-advanced-usage.html
                      • qmake-common-projects.html
                      • qmake-environment-reference.html
                      • qmake-function-reference.html
                      • qmake-language.html
                      • qmake-manual.html
                      • qmake-overview.html
                      • qmake-platform-notes.html
                      • qmake-precompiledheaders.html
                      • qmake-project-files.html
                      • qmake-reference.html
                      • qmake-running.html
                      • qmake-test-function-reference.html
                      • qmake-tutorial.html
                      • qmake-variable-reference.html
                      • qmake.index
                      • qmake.qhp
                      • qmake.qhp.sha1
                      • style
                        • offline-simple.css
                        • offline.css
                    • qt3d.qch
                    • qt3d
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • audio-visualizer-qml-example.png
                        • basicshapes-cpp-example.jpg
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • deferred-framegraph.png
                        • ecs-1.png
                        • ecs-2.png
                        • framegraph-parallel-build.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • materials-cpp.png
                        • materials.png
                        • multiviewport-1.png
                        • multiviewport-2.png
                        • multiviewport-qml-example.png
                        • multiviewport.png
                        • planets-qml-example.jpg
                        • qt3d-wireframe-rendering.png
                        • scene3d.png
                        • shadowmapping-depth.png
                        • shadowmapping-qt3d.png
                        • simple-cpp.png
                        • simple-framegraph.png
                        • simple-qml.png
                        • Space-invaders.jpg
                        • used-in-examples
                          • audio-visualizer-qml
                            • images
                              • albumcover.png
                              • demotitle.png
                              • normalmap.png
                              • pausehoverpressed.png
                              • pausenormal.png
                              • playhoverpressed.png
                              • playnormal.png
                              • songtitle.png
                              • stopdisabled.png
                              • stophoverpressed.png
                              • stopnormal.png
                          • planets-qml
                            • images
                              • earth.png
                              • earthcloudmapcolortrans.png
                              • earthcloudmapspec.jpg
                              • earthmap1k.jpg
                              • earthnormal1k.jpg
                              • earthspec1k.jpg
                              • galaxy_starfield.png
                              • jupiter.png
                              • jupitermap.jpg
                              • mars.png
                              • marsmap1k.jpg
                              • marsnormal1k.jpg
                              • mercury.png
                              • mercurymap.jpg
                              • mercurynormal.jpg
                              • moonmap1k.jpg
                              • moonnormal1k.jpg
                              • neptune.png
                              • neptunemap.jpg
                              • saturn.png
                              • saturnmap.jpg
                              • saturnringcolortrans.png
                              • sun.png
                              • sunmap.jpg
                              • uranus.png
                              • uranusmap.jpg
                              • uranusringcolortrans.png
                              • venus.png
                              • venusmap.jpg
                              • venusnormal.jpg
                        • wave.png
                      • qml-qt3d-core-component3d-members.html
                      • qml-qt3d-core-component3d.html
                      • qml-qt3d-core-entity-members.html
                      • qml-qt3d-core-entity.html
                      • qml-qt3d-core-entityloader-members.html
                      • qml-qt3d-core-entityloader.html
                      • qml-qt3d-core-node-members.html
                      • qml-qt3d-core-node.html
                      • qml-qt3d-core-nodeinstantiator-members.html
                      • qml-qt3d-core-nodeinstantiator.html
                      • qml-qt3d-core-quaternionanimation-members.html
                      • qml-qt3d-core-quaternionanimation.html
                      • qml-qt3d-core-transform-members.html
                      • qml-qt3d-core-transform.html
                      • qml-qt3d-extras-conegeometry-members.html
                      • qml-qt3d-extras-conegeometry.html
                      • qml-qt3d-extras-conemesh-members.html
                      • qml-qt3d-extras-conemesh.html
                      • qml-qt3d-extras-cuboidgeometry-members.html
                      • qml-qt3d-extras-cuboidgeometry.html
                      • qml-qt3d-extras-cuboidmesh-members.html
                      • qml-qt3d-extras-cuboidmesh.html
                      • qml-qt3d-extras-cylindergeometry-members.html
                      • qml-qt3d-extras-cylindergeometry.html
                      • qml-qt3d-extras-cylindermesh-members.html
                      • qml-qt3d-extras-cylindermesh.html
                      • qml-qt3d-extras-diffusemapmaterial-members.html
                      • qml-qt3d-extras-diffusemapmaterial.html
                      • qml-qt3d-extras-diffusespecularmapmaterial-members.html
                      • qml-qt3d-extras-diffusespecularmapmaterial.html
                      • qml-qt3d-extras-firstpersoncameracontroller-members.html
                      • qml-qt3d-extras-firstpersoncameracontroller.html
                      • qml-qt3d-extras-forwardrenderer-members.html
                      • qml-qt3d-extras-forwardrenderer.html
                      • qml-qt3d-extras-goochmaterial-members.html
                      • qml-qt3d-extras-goochmaterial.html
                      • qml-qt3d-extras-normaldiffusemapalphamaterial-members.html
                      • qml-qt3d-extras-normaldiffusemapalphamaterial.html
                      • qml-qt3d-extras-normaldiffusemapmaterial-members.html
                      • qml-qt3d-extras-normaldiffusemapmaterial.html
                      • qml-qt3d-extras-normaldiffusespecularmapmaterial-members.html
                      • qml-qt3d-extras-normaldiffusespecularmapmaterial.html
                      • qml-qt3d-extras-orbitcameracontroller-members.html
                      • qml-qt3d-extras-orbitcameracontroller.html
                      • qml-qt3d-extras-pervertexcolormaterial-members.html
                      • qml-qt3d-extras-pervertexcolormaterial.html
                      • qml-qt3d-extras-phongalphamaterial-members.html
                      • qml-qt3d-extras-phongalphamaterial.html
                      • qml-qt3d-extras-phongmaterial-members.html
                      • qml-qt3d-extras-phongmaterial.html
                      • qml-qt3d-extras-planegeometry-members.html
                      • qml-qt3d-extras-planegeometry.html
                      • qml-qt3d-extras-planemesh-members.html
                      • qml-qt3d-extras-planemesh.html
                      • qml-qt3d-extras-spheregeometry-members.html
                      • qml-qt3d-extras-spheregeometry.html
                      • qml-qt3d-extras-spheremesh-members.html
                      • qml-qt3d-extras-spheremesh.html
                      • qml-qt3d-extras-torusgeometry-members.html
                      • qml-qt3d-extras-torusgeometry.html
                      • qml-qt3d-extras-torusmesh-members.html
                      • qml-qt3d-extras-torusmesh.html
                      • qml-qt3d-input-abstractactioninput-members.html
                      • qml-qt3d-input-abstractactioninput.html
                      • qml-qt3d-input-abstractaxisinput-members.html
                      • qml-qt3d-input-abstractaxisinput.html
                      • qml-qt3d-input-abstractphysicaldevice-members.html
                      • qml-qt3d-input-abstractphysicaldevice.html
                      • qml-qt3d-input-action-members.html
                      • qml-qt3d-input-action.html
                      • qml-qt3d-input-actioninput-members.html
                      • qml-qt3d-input-actioninput.html
                      • qml-qt3d-input-analogaxisinput-members.html
                      • qml-qt3d-input-analogaxisinput.html
                      • qml-qt3d-input-axis-members.html
                      • qml-qt3d-input-axis.html
                      • qml-qt3d-input-axissetting-members.html
                      • qml-qt3d-input-axissetting.html
                      • qml-qt3d-input-buttonaxisinput-members.html
                      • qml-qt3d-input-buttonaxisinput.html
                      • qml-qt3d-input-inputchord-members.html
                      • qml-qt3d-input-inputchord.html
                      • qml-qt3d-input-inputsequence-members.html
                      • qml-qt3d-input-inputsequence.html
                      • qml-qt3d-input-inputsettings-members.html
                      • qml-qt3d-input-inputsettings.html
                      • qml-qt3d-input-keyboarddevice-members.html
                      • qml-qt3d-input-keyboarddevice.html
                      • qml-qt3d-input-keyboardhandler-members.html
                      • qml-qt3d-input-keyboardhandler.html
                      • qml-qt3d-input-keyevent-members.html
                      • qml-qt3d-input-keyevent.html
                      • qml-qt3d-input-logicaldevice-members.html
                      • qml-qt3d-input-logicaldevice.html
                      • qml-qt3d-input-mousedevice-members.html
                      • qml-qt3d-input-mousedevice.html
                      • qml-qt3d-input-mouseevent-members.html
                      • qml-qt3d-input-mouseevent.html
                      • qml-qt3d-input-mousehandler-members.html
                      • qml-qt3d-input-mousehandler.html
                      • qml-qt3d-input-wheelevent-members.html
                      • qml-qt3d-input-wheelevent.html
                      • qml-qt3d-logic-frameaction-members.html
                      • qml-qt3d-logic-frameaction.html
                      • qml-qt3d-render-abstracttextureimage-members.html
                      • qml-qt3d-render-abstracttextureimage.html
                      • qml-qt3d-render-attribute-members.html
                      • qml-qt3d-render-attribute.html
                      • qml-qt3d-render-blendequation-members.html
                      • qml-qt3d-render-blendequation.html
                      • qml-qt3d-render-blendequationarguments-members.html
                      • qml-qt3d-render-blendequationarguments.html
                      • qml-qt3d-render-buffer-members.html
                      • qml-qt3d-render-buffer.html
                      • qml-qt3d-render-camera-members.html
                      • qml-qt3d-render-camera.html
                      • qml-qt3d-render-cameralens-members.html
                      • qml-qt3d-render-cameralens.html
                      • qml-qt3d-render-cameraselector-members.html
                      • qml-qt3d-render-cameraselector.html
                      • qml-qt3d-render-clearbuffers-members.html
                      • qml-qt3d-render-clearbuffers.html
                      • qml-qt3d-render-clipplane-members.html
                      • qml-qt3d-render-clipplane.html
                      • qml-qt3d-render-directionallight-members.html
                      • qml-qt3d-render-directionallight.html
                      • qml-qt3d-render-dispatchcompute-members.html
                      • qml-qt3d-render-dispatchcompute.html
                      • qml-qt3d-render-effect-members.html
                      • qml-qt3d-render-effect.html
                      • qml-qt3d-render-filterkey-members.html
                      • qml-qt3d-render-filterkey.html
                      • qml-qt3d-render-framegraphnode-members.html
                      • qml-qt3d-render-framegraphnode.html
                      • qml-qt3d-render-frustumculling-members.html
                      • qml-qt3d-render-frustumculling.html
                      • qml-qt3d-render-geometry-members.html
                      • qml-qt3d-render-geometry.html
                      • qml-qt3d-render-geometryrenderer-members.html
                      • qml-qt3d-render-geometryrenderer.html
                      • qml-qt3d-render-graphicsapifilter-members.html
                      • qml-qt3d-render-graphicsapifilter.html
                      • qml-qt3d-render-layer-members.html
                      • qml-qt3d-render-layer.html
                      • qml-qt3d-render-layerfilter-members.html
                      • qml-qt3d-render-layerfilter.html
                      • qml-qt3d-render-light-members.html
                      • qml-qt3d-render-light.html
                      • qml-qt3d-render-material-members.html
                      • qml-qt3d-render-material.html
                      • qml-qt3d-render-mesh-members.html
                      • qml-qt3d-render-mesh.html
                      • qml-qt3d-render-nodraw-members.html
                      • qml-qt3d-render-nodraw.html
                      • qml-qt3d-render-objectpicker-members.html
                      • qml-qt3d-render-objectpicker.html
                      • qml-qt3d-render-parameter-members.html
                      • qml-qt3d-render-parameter.html
                      • qml-qt3d-render-pickevent-members.html
                      • qml-qt3d-render-pickevent.html
                      • qml-qt3d-render-pickingsettings-members.html
                      • qml-qt3d-render-pickingsettings.html
                      • qml-qt3d-render-picktriangleevent-members.html
                      • qml-qt3d-render-picktriangleevent.html
                      • qml-qt3d-render-pointlight-members.html
                      • qml-qt3d-render-pointlight.html
                      • qml-qt3d-render-pointsize-members.html
                      • qml-qt3d-render-pointsize.html
                      • qml-qt3d-render-renderpass-members.html
                      • qml-qt3d-render-renderpass.html
                      • qml-qt3d-render-rendersettings-members.html
                      • qml-qt3d-render-rendersettings.html
                      • qml-qt3d-render-rendersurfaceselector-members.html
                      • qml-qt3d-render-rendersurfaceselector.html
                      • qml-qt3d-render-rendertargetselector-members.html
                      • qml-qt3d-render-rendertargetselector.html
                      • qml-qt3d-render-sceneloader-members.html
                      • qml-qt3d-render-sceneloader.html
                      • qml-qt3d-render-shaderprogram-members.html
                      • qml-qt3d-render-shaderprogram.html
                      • qml-qt3d-render-sortpolicy-members.html
                      • qml-qt3d-render-sortpolicy.html
                      • qml-qt3d-render-spotlight-members.html
                      • qml-qt3d-render-spotlight.html
                      • qml-qt3d-render-technique-members.html
                      • qml-qt3d-render-technique.html
                      • qml-qt3d-render-textureimage-members.html
                      • qml-qt3d-render-textureimage.html
                      • qml-qt3d-render-viewport-members.html
                      • qml-qt3d-render-viewport.html
                      • qt3d-audio-visualizer-qml-audio-visualizer-qml-pro.html
                      • qt3d-audio-visualizer-qml-audio-visualizer-qml-qrc.html
                      • qt3d-audio-visualizer-qml-barentity-qml.html
                      • qt3d-audio-visualizer-qml-example.html
                      • qt3d-audio-visualizer-qml-main-cpp.html
                      • qt3d-audio-visualizer-qml-main-qml.html
                      • qt3d-audio-visualizer-qml-touchsettings-cpp.html
                      • qt3d-audio-visualizer-qml-touchsettings-h.html
                      • qt3d-audio-visualizer-qml-visualizer-qml.html
                      • qt3d-basicshapes-cpp-basicshapes-cpp-pro.html
                      • qt3d-basicshapes-cpp-example.html
                      • qt3d-basicshapes-cpp-main-cpp.html
                      • qt3d-basicshapes-cpp-scenemodifier-cpp.html
                      • qt3d-basicshapes-cpp-scenemodifier-h.html
                      • qt3d-core-qmlmodule.html
                      • qt3d-cpp.html
                      • qt3d-deferred-renderer-cpp-deferred-renderer-cpp-pro.html
                      • qt3d-deferred-renderer-cpp-deferred-renderer-cpp-qrc.html
                      • qt3d-deferred-renderer-cpp-example.html
                      • qt3d-deferred-renderer-cpp-final-gl2-vert.html
                      • qt3d-deferred-renderer-cpp-final-gl3-vert.html
                      • qt3d-deferred-renderer-cpp-finaleffect-cpp.html
                      • qt3d-deferred-renderer-cpp-finaleffect-h.html
                      • qt3d-deferred-renderer-cpp-gbuffer-cpp.html
                      • qt3d-deferred-renderer-cpp-gbuffer-h.html
                      • qt3d-deferred-renderer-cpp-geometry-gl2-vert.html
                      • qt3d-deferred-renderer-cpp-geometry-gl3-vert.html
                      • qt3d-deferred-renderer-cpp-pointlightblock-cpp.html
                      • qt3d-deferred-renderer-cpp-pointlightblock-h.html
                      • qt3d-deferred-renderer-cpp-sceneeffect-cpp.html
                      • qt3d-deferred-renderer-cpp-sceneeffect-h.html
                      • qt3d-examples.html
                      • qt3d-extras-qmlmodule.html
                      • qt3d-index.html
                      • qt3d-input-qmlmodule.html
                      • qt3d-logic-qmlmodule.html
                      • qt3d-materials-barrel-qml.html
                      • qt3d-materials-basiccamera-qml.html
                      • qt3d-materials-chest-qml.html
                      • qt3d-materials-cpp-barrel-cpp.html
                      • qt3d-materials-cpp-barrel-h.html
                      • qt3d-materials-cpp-example.html
                      • qt3d-materials-cpp-houseplant-cpp.html
                      • qt3d-materials-cpp-houseplant-h.html
                      • qt3d-materials-cpp-main-cpp.html
                      • qt3d-materials-cpp-materials-cpp-pro.html
                      • qt3d-materials-cpp-planeentity-cpp.html
                      • qt3d-materials-cpp-planeentity-h.html
                      • qt3d-materials-cpp-renderableentity-cpp.html
                      • qt3d-materials-cpp-renderableentity-h.html
                      • qt3d-materials-cpp-rotatingtrefoilknot-cpp.html
                      • qt3d-materials-cpp-rotatingtrefoilknot-h.html
                      • qt3d-materials-cpp-trefoilknot-cpp.html
                      • qt3d-materials-cpp-trefoilknot-h.html
                      • qt3d-materials-example.html
                      • qt3d-materials-houseplant-qml.html
                      • qt3d-materials-lights-qml.html
                      • qt3d-materials-main-cpp.html
                      • qt3d-materials-main-qml.html
                      • qt3d-materials-materials-pro.html
                      • qt3d-materials-materials-qrc.html
                      • qt3d-materials-planeentity-qml.html
                      • qt3d-materials-renderableentity-qml.html
                      • qt3d-materials-sortedforwardrenderer-qml.html
                      • qt3d-materials-trefoilknot-qml.html
                      • qt3d-multiviewport-example.html
                      • qt3d-multiviewport-main-cpp.html
                      • qt3d-multiviewport-main-qml.html
                      • qt3d-multiviewport-multiviewport-pro.html
                      • qt3d-multiviewport-multiviewport-qrc.html
                      • qt3d-multiviewport-quadviewportframegraph-qml.html
                      • qt3d-multiviewport-simplecamera-qml.html
                      • qt3d-overview.html
                      • qt3d-planets-qml-android-androidmanifest-xml.html
                      • qt3d-planets-qml-example.html
                      • qt3d-planets-qml-fpsdisplay-qml.html
                      • qt3d-planets-qml-infosheet-qml.html
                      • qt3d-planets-qml-main-cpp.html
                      • qt3d-planets-qml-planet-qml.html
                      • qt3d-planets-qml-planetbutton-qml.html
                      • qt3d-planets-qml-planeteffect-qml.html
                      • qt3d-planets-qml-planetframegraph-qml.html
                      • qt3d-planets-qml-planetmaterial-qml.html
                      • qt3d-planets-qml-planets-js.html
                      • qt3d-planets-qml-planets-qml-images-qrc.html
                      • qt3d-planets-qml-planets-qml-pro.html
                      • qt3d-planets-qml-planets-qml-qrc.html
                      • qt3d-planets-qml-planetslight-qml.html
                      • qt3d-planets-qml-planetsmain-qml.html
                      • qt3d-planets-qml-ring-qml.html
                      • qt3d-planets-qml-shaders-es2-planetd-vert.html
                      • qt3d-planets-qml-shaders-es2-planetdb-vert.html
                      • qt3d-planets-qml-shaders-es2-sun-vert.html
                      • qt3d-planets-qml-shaders-gl3-planetd-vert.html
                      • qt3d-planets-qml-shaders-gl3-planetdb-vert.html
                      • qt3d-planets-qml-shaders-gl3-planetdshadow-vert.html
                      • qt3d-planets-qml-shaders-gl3-shadowmap-vert.html
                      • qt3d-planets-qml-shaders-gl3-sun-vert.html
                      • qt3d-planets-qml-shadoweffect-qml.html
                      • qt3d-planets-qml-solarsystem-qml.html
                      • qt3d-planets-qml-styledslider-qml.html
                      • qt3d-planets-qml-suneffect-qml.html
                      • qt3d-render-qmlmodule.html
                      • qt3d-scene3d-animatedentity-qml.html
                      • qt3d-scene3d-example.html
                      • qt3d-scene3d-main-cpp.html
                      • qt3d-scene3d-main-qml.html
                      • qt3d-scene3d-scene3d-pro.html
                      • qt3d-scene3d-scene3d-qrc.html
                      • qt3d-shadow-map-qml-adseffect-qml.html
                      • qt3d-shadow-map-qml-adsmaterial-qml.html
                      • qt3d-shadow-map-qml-example.html
                      • qt3d-shadow-map-qml-groundplane-qml.html
                      • qt3d-shadow-map-qml-main-cpp.html
                      • qt3d-shadow-map-qml-main-qml.html
                      • qt3d-shadow-map-qml-shaders-ads-vert.html
                      • qt3d-shadow-map-qml-shaders-es3-ads-vert.html
                      • qt3d-shadow-map-qml-shaders-es3-shadowmap-vert.html
                      • qt3d-shadow-map-qml-shaders-shadowmap-vert.html
                      • qt3d-shadow-map-qml-shadow-map-qml-pro.html
                      • qt3d-shadow-map-qml-shadow-map-qml-qrc.html
                      • qt3d-shadow-map-qml-shadowmapframegraph-qml.html
                      • qt3d-shadow-map-qml-shadowmaplight-qml.html
                      • qt3d-shadow-map-qml-toyplane-qml.html
                      • qt3d-shadow-map-qml-trefoil-qml.html
                      • qt3d-simple-cpp-example.html
                      • qt3d-simple-cpp-main-cpp.html
                      • qt3d-simple-cpp-orbittransformcontroller-cpp.html
                      • qt3d-simple-cpp-orbittransformcontroller-h.html
                      • qt3d-simple-cpp-simple-cpp-pro.html
                      • qt3d-simple-qml-cameracontroller-qml.html
                      • qt3d-simple-qml-example.html
                      • qt3d-simple-qml-main-cpp.html
                      • qt3d-simple-qml-main-qml.html
                      • qt3d-simple-qml-simple-qml-pro.html
                      • qt3d-simple-qml-simple-qml-qrc.html
                      • qt3d-wave-background-qml.html
                      • qt3d-wave-backgroundeffect-qml.html
                      • qt3d-wave-basiccamera-qml.html
                      • qt3d-wave-example.html
                      • qt3d-wave-main-cpp.html
                      • qt3d-wave-main-qml.html
                      • qt3d-wave-shaders-background-vert.html
                      • qt3d-wave-shaders-ribbon-vert.html
                      • qt3d-wave-shaders-robustwireframe-geom.html
                      • qt3d-wave-wave-pro.html
                      • qt3d-wave-wave-qml.html
                      • qt3d-wave-wave-qrc.html
                      • qt3d-wave-waveeffect-qml.html
                      • qt3d-wave-waveforwardrenderer-qml.html
                      • qt3d-wave-wavematerial-qml.html
                      • qt3d-wireframe-basiccamera-qml.html
                      • qt3d-wireframe-example.html
                      • qt3d-wireframe-main-cpp.html
                      • qt3d-wireframe-main-qml.html
                      • qt3d-wireframe-shaders-robustwireframe-geom.html
                      • qt3d-wireframe-shaders-robustwireframe-vert.html
                      • qt3d-wireframe-trefoilknot-qml.html
                      • qt3d-wireframe-wireframe-pro.html
                      • qt3d-wireframe-wireframe-qrc.html
                      • qt3d-wireframe-wireframeeffect-qml.html
                      • qt3d-wireframe-wireframematerial-qml.html
                      • qt3d.index
                      • qt3d.qhp
                      • qt3d.qhp.sha1
                      • qt3d.tags
                      • qt3dcore-module.html
                      • qt3dcore-qabstractaspect-members.html
                      • qt3dcore-qabstractaspect.html
                      • qt3dcore-qaspectengine-members.html
                      • qt3dcore-qaspectengine.html
                      • qt3dcore-qaspectjob-members.html
                      • qt3dcore-qaspectjob.html
                      • qt3dcore-qbackendnode-members.html
                      • qt3dcore-qbackendnode.html
                      • qt3dcore-qbackendnodemapper-members.html
                      • qt3dcore-qbackendnodemapper.html
                      • qt3dcore-qcomponent-members.html
                      • qt3dcore-qcomponent.html
                      • qt3dcore-qcomponentaddedchange-members.html
                      • qt3dcore-qcomponentaddedchange.html
                      • qt3dcore-qcomponentremovedchange-members.html
                      • qt3dcore-qcomponentremovedchange.html
                      • qt3dcore-qdynamicpropertyupdatedchange-members.html
                      • qt3dcore-qdynamicpropertyupdatedchange.html
                      • qt3dcore-qentity-members.html
                      • qt3dcore-qentity.html
                      • qt3dcore-qnode-members.html
                      • qt3dcore-qnode.html
                      • qt3dcore-qnodecreatedchange-members.html
                      • qt3dcore-qnodecreatedchange.html
                      • qt3dcore-qnodecreatedchangebase-members.html
                      • qt3dcore-qnodecreatedchangebase.html
                      • qt3dcore-qnodedestroyedchange-members.html
                      • qt3dcore-qnodedestroyedchange.html
                      • qt3dcore-qnodeid-members.html
                      • qt3dcore-qnodeid.html
                      • qt3dcore-qnodeidtypepair-members.html
                      • qt3dcore-qnodeidtypepair.html
                      • qt3dcore-qpropertynodeaddedchange-members.html
                      • qt3dcore-qpropertynodeaddedchange.html
                      • qt3dcore-qpropertynoderemovedchange-members.html
                      • qt3dcore-qpropertynoderemovedchange.html
                      • qt3dcore-qpropertyupdatedchange-members.html
                      • qt3dcore-qpropertyupdatedchange.html
                      • qt3dcore-qpropertyupdatedchangebase-members.html
                      • qt3dcore-qpropertyupdatedchangebase.html
                      • qt3dcore-qpropertyvalueaddedchange-members.html
                      • qt3dcore-qpropertyvalueaddedchange.html
                      • qt3dcore-qpropertyvalueaddedchangebase-members.html
                      • qt3dcore-qpropertyvalueaddedchangebase.html
                      • qt3dcore-qpropertyvalueremovedchange-members.html
                      • qt3dcore-qpropertyvalueremovedchange.html
                      • qt3dcore-qpropertyvalueremovedchangebase-members.html
                      • qt3dcore-qpropertyvalueremovedchangebase.html
                      • qt3dcore-qscenechange-members.html
                      • qt3dcore-qscenechange.html
                      • qt3dcore-qstaticpropertyupdatedchangebase-members.html
                      • qt3dcore-qstaticpropertyupdatedchangebase.html
                      • qt3dcore-qstaticpropertyvalueaddedchangebase-members.html
                      • qt3dcore-qstaticpropertyvalueaddedchangebase.html
                      • qt3dcore-qstaticpropertyvalueremovedchangebase-members.html
                      • qt3dcore-qstaticpropertyvalueremovedchangebase.html
                      • qt3dcore-qtransform-members.html
                      • qt3dcore-qtransform.html
                      • qt3dcore-quick-qqmlaspectengine-members.html
                      • qt3dcore-quick-qqmlaspectengine.html
                      • qt3dcore-quick.html
                      • qt3dcore.html
                      • qt3dextras-module.html
                      • qt3dextras-qconegeometry-members.html
                      • qt3dextras-qconegeometry.html
                      • qt3dextras-qconemesh-members.html
                      • qt3dextras-qconemesh.html
                      • qt3dextras-qcuboidgeometry-members.html
                      • qt3dextras-qcuboidgeometry.html
                      • qt3dextras-qcuboidmesh-members.html
                      • qt3dextras-qcuboidmesh.html
                      • qt3dextras-qcylindergeometry-members.html
                      • qt3dextras-qcylindergeometry.html
                      • qt3dextras-qcylindermesh-members.html
                      • qt3dextras-qcylindermesh.html
                      • qt3dextras-qdiffusemapmaterial-members.html
                      • qt3dextras-qdiffusemapmaterial.html
                      • qt3dextras-qdiffusespecularmapmaterial-members.html
                      • qt3dextras-qdiffusespecularmapmaterial.html
                      • qt3dextras-qfirstpersoncameracontroller-members.html
                      • qt3dextras-qfirstpersoncameracontroller.html
                      • qt3dextras-qforwardrenderer-members.html
                      • qt3dextras-qforwardrenderer.html
                      • qt3dextras-qgoochmaterial-members.html
                      • qt3dextras-qgoochmaterial.html
                      • qt3dextras-qnormaldiffusemapalphamaterial-members.html
                      • qt3dextras-qnormaldiffusemapalphamaterial.html
                      • qt3dextras-qnormaldiffusemapmaterial-members.html
                      • qt3dextras-qnormaldiffusemapmaterial.html
                      • qt3dextras-qnormaldiffusespecularmapmaterial-members.html
                      • qt3dextras-qnormaldiffusespecularmapmaterial.html
                      • qt3dextras-qorbitcameracontroller-members.html
                      • qt3dextras-qorbitcameracontroller.html
                      • qt3dextras-qpervertexcolormaterial-members.html
                      • qt3dextras-qpervertexcolormaterial.html
                      • qt3dextras-qphongalphamaterial-members.html
                      • qt3dextras-qphongalphamaterial.html
                      • qt3dextras-qphongmaterial-members.html
                      • qt3dextras-qphongmaterial.html
                      • qt3dextras-qplanegeometry-members.html
                      • qt3dextras-qplanegeometry.html
                      • qt3dextras-qplanemesh-members.html
                      • qt3dextras-qplanemesh.html
                      • qt3dextras-qskyboxentity-members.html
                      • qt3dextras-qskyboxentity.html
                      • qt3dextras-qspheregeometry-members.html
                      • qt3dextras-qspheregeometry.html
                      • qt3dextras-qspheremesh-members.html
                      • qt3dextras-qspheremesh.html
                      • qt3dextras-qt3dwindow-members.html
                      • qt3dextras-qt3dwindow.html
                      • qt3dextras-qtorusgeometry-members.html
                      • qt3dextras-qtorusgeometry.html
                      • qt3dextras-qtorusmesh-members.html
                      • qt3dextras-qtorusmesh.html
                      • qt3dextras.html
                      • qt3dinput-module.html
                      • qt3dinput-qabstractactioninput-members.html
                      • qt3dinput-qabstractactioninput.html
                      • qt3dinput-qabstractaxisinput-members.html
                      • qt3dinput-qabstractaxisinput.html
                      • qt3dinput-qabstractphysicaldevice-members.html
                      • qt3dinput-qabstractphysicaldevice.html
                      • qt3dinput-qaction-members.html
                      • qt3dinput-qaction.html
                      • qt3dinput-qactioninput-members.html
                      • qt3dinput-qactioninput.html
                      • qt3dinput-qanalogaxisinput-members.html
                      • qt3dinput-qanalogaxisinput.html
                      • qt3dinput-qaxis-members.html
                      • qt3dinput-qaxis.html
                      • qt3dinput-qaxissetting-members.html
                      • qt3dinput-qaxissetting.html
                      • qt3dinput-qbuttonaxisinput-members.html
                      • qt3dinput-qbuttonaxisinput.html
                      • qt3dinput-qinputaspect-members.html
                      • qt3dinput-qinputaspect.html
                      • qt3dinput-qinputchord-members.html
                      • qt3dinput-qinputchord.html
                      • qt3dinput-qinputsequence-members.html
                      • qt3dinput-qinputsequence.html
                      • qt3dinput-qinputsettings-members.html
                      • qt3dinput-qinputsettings.html
                      • qt3dinput-qkeyboarddevice-members.html
                      • qt3dinput-qkeyboarddevice.html
                      • qt3dinput-qkeyboardhandler-members.html
                      • qt3dinput-qkeyboardhandler.html
                      • qt3dinput-qkeyevent-members.html
                      • qt3dinput-qkeyevent.html
                      • qt3dinput-qlogicaldevice-members.html
                      • qt3dinput-qlogicaldevice.html
                      • qt3dinput-qmousedevice-members.html
                      • qt3dinput-qmousedevice.html
                      • qt3dinput-qmouseevent-members.html
                      • qt3dinput-qmouseevent.html
                      • qt3dinput-qmousehandler-members.html
                      • qt3dinput-qmousehandler.html
                      • qt3dinput-qphysicaldevicecreatedchange-members.html
                      • qt3dinput-qphysicaldevicecreatedchange.html
                      • qt3dinput-qphysicaldevicecreatedchangebase-members.html
                      • qt3dinput-qphysicaldevicecreatedchangebase.html
                      • qt3dinput-qwheelevent-members.html
                      • qt3dinput-qwheelevent.html
                      • qt3dinput.html
                      • qt3dlogic-logic.html
                      • qt3dlogic-module.html
                      • qt3dlogic-qframeaction-members.html
                      • qt3dlogic-qframeaction.html
                      • qt3dlogic-qlogicaspect-members.html
                      • qt3dlogic-qlogicaspect.html
                      • qt3dlogic.html
                      • qt3drender-assimphelper.html
                      • qt3drender-assimpio-members.html
                      • qt3drender-assimpio.html
                      • qt3drender-framegraph.html
                      • qt3drender-functortype-members.html
                      • qt3drender-functortype.html
                      • qt3drender-geometry.html
                      • qt3drender-gltfio-members.html
                      • qt3drender-gltfio.html
                      • qt3drender-module.html
                      • qt3drender-propertyreaderinterface-members.html
                      • qt3drender-propertyreaderinterface.html
                      • qt3drender-protips.html
                      • qt3drender-qabstractfunctor-members.html
                      • qt3drender-qabstractfunctor.html
                      • qt3drender-qabstractlight-members.html
                      • qt3drender-qabstractlight.html
                      • qt3drender-qabstracttexture-members.html
                      • qt3drender-qabstracttexture.html
                      • qt3drender-qabstracttextureimage-members.html
                      • qt3drender-qabstracttextureimage.html
                      • qt3drender-qalphacoverage-members.html
                      • qt3drender-qalphacoverage.html
                      • qt3drender-qalphatest-members.html
                      • qt3drender-qalphatest.html
                      • qt3drender-qattribute-members.html
                      • qt3drender-qattribute.html
                      • qt3drender-qblendequation-members.html
                      • qt3drender-qblendequation.html
                      • qt3drender-qblendequationarguments-members.html
                      • qt3drender-qblendequationarguments.html
                      • qt3drender-qbuffer-members.html
                      • qt3drender-qbuffer.html
                      • qt3drender-qbufferdatagenerator-members.html
                      • qt3drender-qbufferdatagenerator.html
                      • qt3drender-qcamera-members.html
                      • qt3drender-qcamera.html
                      • qt3drender-qcameralens-members.html
                      • qt3drender-qcameralens.html
                      • qt3drender-qcameraselector-members.html
                      • qt3drender-qcameraselector.html
                      • qt3drender-qclearbuffers-members.html
                      • qt3drender-qclearbuffers.html
                      • qt3drender-qclipplane-members.html
                      • qt3drender-qclipplane.html
                      • qt3drender-qcolormask-members.html
                      • qt3drender-qcolormask.html
                      • qt3drender-qcomputecommand-members.html
                      • qt3drender-qcomputecommand.html
                      • qt3drender-qcullface-members.html
                      • qt3drender-qcullface.html
                      • qt3drender-qdepthtest-members.html
                      • qt3drender-qdepthtest.html
                      • qt3drender-qdirectionallight-members.html
                      • qt3drender-qdirectionallight.html
                      • qt3drender-qdispatchcompute-members.html
                      • qt3drender-qdispatchcompute.html
                      • qt3drender-qdithering-members.html
                      • qt3drender-qdithering.html
                      • qt3drender-qeffect-members.html
                      • qt3drender-qeffect.html
                      • qt3drender-qfilterkey-members.html
                      • qt3drender-qfilterkey.html
                      • qt3drender-qframegraphnode-members.html
                      • qt3drender-qframegraphnode.html
                      • qt3drender-qfrontface-members.html
                      • qt3drender-qfrontface.html
                      • qt3drender-qfrustumculling-members.html
                      • qt3drender-qfrustumculling.html
                      • qt3drender-qgeometry-members.html
                      • qt3drender-qgeometry.html
                      • qt3drender-qgeometryfactory-members.html
                      • qt3drender-qgeometryfactory.html
                      • qt3drender-qgeometryrenderer-members.html
                      • qt3drender-qgeometryrenderer.html
                      • qt3drender-qgraphicsapifilter-members.html
                      • qt3drender-qgraphicsapifilter.html
                      • qt3drender-qlayer-members.html
                      • qt3drender-qlayer.html
                      • qt3drender-qlayerfilter-members.html
                      • qt3drender-qlayerfilter.html
                      • qt3drender-qmaterial-members.html
                      • qt3drender-qmaterial.html
                      • qt3drender-qmesh-members.html
                      • qt3drender-qmesh.html
                      • qt3drender-qmultisampleantialiasing-members.html
                      • qt3drender-qmultisampleantialiasing.html
                      • qt3drender-qnodepthmask-members.html
                      • qt3drender-qnodepthmask.html
                      • qt3drender-qnodraw-members.html
                      • qt3drender-qnodraw.html
                      • qt3drender-qobjectpicker-members.html
                      • qt3drender-qobjectpicker.html
                      • qt3drender-qparameter-members.html
                      • qt3drender-qparameter.html
                      • qt3drender-qpickevent-members.html
                      • qt3drender-qpickevent.html
                      • qt3drender-qpickingsettings-members.html
                      • qt3drender-qpickingsettings.html
                      • qt3drender-qpicktriangleevent-members.html
                      • qt3drender-qpicktriangleevent.html
                      • qt3drender-qpointlight-members.html
                      • qt3drender-qpointlight.html
                      • qt3drender-qpointsize-members.html
                      • qt3drender-qpointsize.html
                      • qt3drender-qpolygonoffset-members.html
                      • qt3drender-qpolygonoffset.html
                      • qt3drender-qrenderaspect-members.html
                      • qt3drender-qrenderaspect.html
                      • qt3drender-qrenderpass-members.html
                      • qt3drender-qrenderpass.html
                      • qt3drender-qrenderpassfilter-members.html
                      • qt3drender-qrenderpassfilter.html
                      • qt3drender-qrendersettings-members.html
                      • qt3drender-qrendersettings.html
                      • qt3drender-qrenderstate-members.html
                      • qt3drender-qrenderstate.html
                      • qt3drender-qrenderstateset-members.html
                      • qt3drender-qrenderstateset.html
                      • qt3drender-qrendersurfaceselector-members.html
                      • qt3drender-qrendersurfaceselector.html
                      • qt3drender-qrendertarget-members.html
                      • qt3drender-qrendertarget.html
                      • qt3drender-qrendertargetoutput-members.html
                      • qt3drender-qrendertargetoutput.html
                      • qt3drender-qrendertargetselector-members.html
                      • qt3drender-qrendertargetselector.html
                      • qt3drender-qsceneloader-members.html
                      • qt3drender-qsceneloader.html
                      • qt3drender-qscissortest-members.html
                      • qt3drender-qscissortest.html
                      • qt3drender-qseamlesscubemap-members.html
                      • qt3drender-qseamlesscubemap.html
                      • qt3drender-qshaderdata-members.html
                      • qt3drender-qshaderdata.html
                      • qt3drender-qshaderprogram-members.html
                      • qt3drender-qshaderprogram.html
                      • qt3drender-qsortcriterion-members.html
                      • qt3drender-qsortcriterion.html
                      • qt3drender-qsortpolicy-members.html
                      • qt3drender-qsortpolicy.html
                      • qt3drender-qspotlight-members.html
                      • qt3drender-qspotlight.html
                      • qt3drender-qstencilmask-members.html
                      • qt3drender-qstencilmask.html
                      • qt3drender-qstenciloperation-members.html
                      • qt3drender-qstenciloperation.html
                      • qt3drender-qstenciloperationarguments-members.html
                      • qt3drender-qstenciloperationarguments.html
                      • qt3drender-qstenciltest-members.html
                      • qt3drender-qstenciltest.html
                      • qt3drender-qstenciltestarguments-members.html
                      • qt3drender-qstenciltestarguments.html
                      • qt3drender-qtechnique-members.html
                      • qt3drender-qtechnique.html
                      • qt3drender-qtechniquefilter-members.html
                      • qt3drender-qtechniquefilter.html
                      • qt3drender-qtexture1d-members.html
                      • qt3drender-qtexture1d.html
                      • qt3drender-qtexture1darray-members.html
                      • qt3drender-qtexture1darray.html
                      • qt3drender-qtexture2d-members.html
                      • qt3drender-qtexture2d.html
                      • qt3drender-qtexture2darray-members.html
                      • qt3drender-qtexture2darray.html
                      • qt3drender-qtexture2dmultisample-members.html
                      • qt3drender-qtexture2dmultisample.html
                      • qt3drender-qtexture2dmultisamplearray-members.html
                      • qt3drender-qtexture2dmultisamplearray.html
                      • qt3drender-qtexture3d-members.html
                      • qt3drender-qtexture3d.html
                      • qt3drender-qtexturebuffer-members.html
                      • qt3drender-qtexturebuffer.html
                      • qt3drender-qtexturecubemap-members.html
                      • qt3drender-qtexturecubemap.html
                      • qt3drender-qtexturecubemaparray-members.html
                      • qt3drender-qtexturecubemaparray.html
                      • qt3drender-qtexturedata-members.html
                      • qt3drender-qtexturedata.html
                      • qt3drender-qtexturegenerator-members.html
                      • qt3drender-qtexturegenerator.html
                      • qt3drender-qtextureimage-members.html
                      • qt3drender-qtextureimage.html
                      • qt3drender-qtextureimagedata-members.html
                      • qt3drender-qtextureimagedata.html
                      • qt3drender-qtextureimagedatagenerator-members.html
                      • qt3drender-qtextureimagedatagenerator.html
                      • qt3drender-qtextureloader-members.html
                      • qt3drender-qtextureloader.html
                      • qt3drender-qtexturerectangle-members.html
                      • qt3drender-qtexturerectangle.html
                      • qt3drender-qtexturewrapmode-members.html
                      • qt3drender-qtexturewrapmode.html
                      • qt3drender-qviewport-members.html
                      • qt3drender-qviewport.html
                      • qt3drender-render.html
                      • qt3drender.html
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtandroidextras.qch
                    • qtandroidextras
                      • examples-manifest.xml
                      • examples-qtandroidextras.html
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • notification.png
                        • used-in-examples
                          • notification
                            • images
                              • happy.png
                              • sad.png
                      • qandroidactivityresultreceiver-members.html
                      • qandroidactivityresultreceiver.html
                      • qandroidjnienvironment-members.html
                      • qandroidjnienvironment.html
                      • qandroidjniobject-members.html
                      • qandroidjniobject.html
                      • qtandroid.html
                      • qtandroidextras-index.html
                      • qtandroidextras-module.html
                      • qtandroidextras-notification-android-sources-androidmanifest-xml.html
                      • qtandroidextras-notification-android-sources-src-org-qtproject-example-notification-notificationclient-java.html
                      • qtandroidextras-notification-example.html
                      • qtandroidextras-notification-main-cpp.html
                      • qtandroidextras-notification-main-qrc.html
                      • qtandroidextras-notification-notification-pro.html
                      • qtandroidextras-notification-notificationclient-cpp.html
                      • qtandroidextras-notification-notificationclient-h.html
                      • qtandroidextras-notification-qml-main-qml.html
                      • qtandroidextras.index
                      • qtandroidextras.qhp
                      • qtandroidextras.qhp.sha1
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtassistant.qch
                    • qtassistant
                      • assistant-custom-help-viewer.html
                      • assistant-details.html
                      • assistant-quick-guide.html
                      • examples-manifest.xml
                      • examples-qtassistant.html
                      • images
                        • arrow_bc.png
                        • assistant-assistant.png
                        • assistant-bookmarks.png
                        • assistant-dockwidgets.png
                        • assistant-examples.png
                        • assistant-index.png
                        • assistant-preferences-documentation.png
                        • assistant-preferences-filters.png
                        • assistant-preferences-fonts.png
                        • assistant-preferences-options.png
                        • assistant-search.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • simpletextviewer-example.png
                        • simpletextviewer-findfiledialog.png
                        • simpletextviewer-mainwindow.png
                      • qtassistant-index.html
                      • qtassistant-remotecontrol-example.html
                      • qtassistant-remotecontrol-main-cpp.html
                      • qtassistant-remotecontrol-remotecontrol-cpp.html
                      • qtassistant-remotecontrol-remotecontrol-h.html
                      • qtassistant-remotecontrol-remotecontrol-pro.html
                      • qtassistant-remotecontrol-remotecontrol-qrc.html
                      • qtassistant-remotecontrol-remotecontrol-ui.html
                      • qtassistant-simpletextviewer-assistant-cpp.html
                      • qtassistant-simpletextviewer-assistant-h.html
                      • qtassistant-simpletextviewer-documentation-simpletextviewer-qhcp.html
                      • qtassistant-simpletextviewer-documentation-simpletextviewer-qhp.html
                      • qtassistant-simpletextviewer-example.html
                      • qtassistant-simpletextviewer-findfiledialog-cpp.html
                      • qtassistant-simpletextviewer-findfiledialog-h.html
                      • qtassistant-simpletextviewer-main-cpp.html
                      • qtassistant-simpletextviewer-mainwindow-cpp.html
                      • qtassistant-simpletextviewer-mainwindow-h.html
                      • qtassistant-simpletextviewer-simpletextviewer-pro.html
                      • qtassistant-simpletextviewer-textedit-cpp.html
                      • qtassistant-simpletextviewer-textedit-h.html
                      • qtassistant.index
                      • qtassistant.qhp
                      • qtassistant.qhp.sha1
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtbluetooth.qch
                    • qtbluetooth
                      • bluetooth-examples.html
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btchat-example.png
                        • btfiletransfer-example.png
                        • btn_next.png
                        • btn_prev.png
                        • btscanner-example.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • chat-view.png
                        • devicescan.png
                        • heartratefound.png
                        • heartratemonitor.png
                        • heartrateresults.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • intro.png
                        • intro1.png
                        • logo.png
                        • lowenergyscanner-chars.png
                        • lowenergyscanner-devices.png
                        • lowenergyscanner-services.png
                        • opp-example-1.png
                        • opp-example-2.png
                        • opp-example-3.png
                        • peripheral-structure.png
                        • servicescan.png
                        • used-in-examples
                          • chat
                            • images
                              • clear.png
                              • default.png
                              • lineedit-bg.png
                      • qbluetooth.html
                      • qbluetoothaddress-members.html
                      • qbluetoothaddress.html
                      • qbluetoothdevicediscoveryagent-members.html
                      • qbluetoothdevicediscoveryagent.html
                      • qbluetoothdeviceinfo-members.html
                      • qbluetoothdeviceinfo.html
                      • qbluetoothhostinfo-members.html
                      • qbluetoothhostinfo.html
                      • qbluetoothlocaldevice-members.html
                      • qbluetoothlocaldevice.html
                      • qbluetoothserver-members.html
                      • qbluetoothserver.html
                      • qbluetoothservicediscoveryagent-members.html
                      • qbluetoothservicediscoveryagent.html
                      • qbluetoothserviceinfo-alternative-members.html
                      • qbluetoothserviceinfo-alternative.html
                      • qbluetoothserviceinfo-members.html
                      • qbluetoothserviceinfo-sequence-members.html
                      • qbluetoothserviceinfo-sequence.html
                      • qbluetoothserviceinfo.html
                      • qbluetoothsocket-members.html
                      • qbluetoothsocket.html
                      • qbluetoothtransfermanager-members.html
                      • qbluetoothtransfermanager.html
                      • qbluetoothtransferreply-members.html
                      • qbluetoothtransferreply.html
                      • qbluetoothtransferrequest-members.html
                      • qbluetoothtransferrequest.html
                      • qbluetoothuuid-members.html
                      • qbluetoothuuid.html
                      • qlowenergyadvertisingdata-members.html
                      • qlowenergyadvertisingdata.html
                      • qlowenergyadvertisingparameters-addressinfo-members.html
                      • qlowenergyadvertisingparameters-addressinfo.html
                      • qlowenergyadvertisingparameters-members.html
                      • qlowenergyadvertisingparameters.html
                      • qlowenergycharacteristic-members.html
                      • qlowenergycharacteristic.html
                      • qlowenergycharacteristicdata-members.html
                      • qlowenergycharacteristicdata.html
                      • qlowenergyconnectionparameters-members.html
                      • qlowenergyconnectionparameters.html
                      • qlowenergycontroller-members.html
                      • qlowenergycontroller-obsolete.html
                      • qlowenergycontroller.html
                      • qlowenergydescriptor-members.html
                      • qlowenergydescriptor.html
                      • qlowenergydescriptordata-members.html
                      • qlowenergydescriptordata.html
                      • qlowenergyservice-members.html
                      • qlowenergyservice.html
                      • qlowenergyservicedata-members.html
                      • qlowenergyservicedata.html
                      • qml-qtbluetooth-bluetoothdiscoverymodel-members.html
                      • qml-qtbluetooth-bluetoothdiscoverymodel.html
                      • qml-qtbluetooth-bluetoothservice-members.html
                      • qml-qtbluetooth-bluetoothservice.html
                      • qml-qtbluetooth-bluetoothsocket-members.html
                      • qml-qtbluetooth-bluetoothsocket.html
                      • qtbluetooth-btchat-btchat-pro.html
                      • qtbluetooth-btchat-chat-cpp.html
                      • qtbluetooth-btchat-chat-h.html
                      • qtbluetooth-btchat-chat-ui.html
                      • qtbluetooth-btchat-chatclient-cpp.html
                      • qtbluetooth-btchat-chatclient-h.html
                      • qtbluetooth-btchat-chatserver-cpp.html
                      • qtbluetooth-btchat-chatserver-h.html
                      • qtbluetooth-btchat-example.html
                      • qtbluetooth-btchat-main-cpp.html
                      • qtbluetooth-btchat-remoteselector-cpp.html
                      • qtbluetooth-btchat-remoteselector-h.html
                      • qtbluetooth-btchat-remoteselector-ui.html
                      • qtbluetooth-btfiletransfer-btfiletransfer-pro.html
                      • qtbluetooth-btfiletransfer-btfiletransfer-qrc.html
                      • qtbluetooth-btfiletransfer-example.html
                      • qtbluetooth-btfiletransfer-main-cpp.html
                      • qtbluetooth-btfiletransfer-pindisplay-cpp.html
                      • qtbluetooth-btfiletransfer-pindisplay-h.html
                      • qtbluetooth-btfiletransfer-pindisplay-ui.html
                      • qtbluetooth-btfiletransfer-progress-cpp.html
                      • qtbluetooth-btfiletransfer-progress-h.html
                      • qtbluetooth-btfiletransfer-progress-ui.html
                      • qtbluetooth-btfiletransfer-remoteselector-cpp.html
                      • qtbluetooth-btfiletransfer-remoteselector-h.html
                      • qtbluetooth-btfiletransfer-remoteselector-ui.html
                      • qtbluetooth-btscanner-btscanner-pro.html
                      • qtbluetooth-btscanner-device-cpp.html
                      • qtbluetooth-btscanner-device-h.html
                      • qtbluetooth-btscanner-device-ui.html
                      • qtbluetooth-btscanner-example.html
                      • qtbluetooth-btscanner-main-cpp.html
                      • qtbluetooth-btscanner-service-cpp.html
                      • qtbluetooth-btscanner-service-h.html
                      • qtbluetooth-btscanner-service-ui.html
                      • qtbluetooth-chat-button-qml.html
                      • qtbluetooth-chat-chat-pro.html
                      • qtbluetooth-chat-chat-qml.html
                      • qtbluetooth-chat-chat-qrc.html
                      • qtbluetooth-chat-example.html
                      • qtbluetooth-chat-inputbox-qml.html
                      • qtbluetooth-chat-qmlchat-cpp.html
                      • qtbluetooth-chat-search-qml.html
                      • qtbluetooth-heartlistener-assets-button-qml.html
                      • qtbluetooth-heartlistener-assets-dialog-qml.html
                      • qtbluetooth-heartlistener-assets-draw-js.html
                      • qtbluetooth-heartlistener-assets-home-qml.html
                      • qtbluetooth-heartlistener-assets-main-qml.html
                      • qtbluetooth-heartlistener-assets-monitor-qml.html
                      • qtbluetooth-heartlistener-assets-point-qml.html
                      • qtbluetooth-heartlistener-assets-results-qml.html
                      • qtbluetooth-heartlistener-deviceinfo-cpp.html
                      • qtbluetooth-heartlistener-deviceinfo-h.html
                      • qtbluetooth-heartlistener-example.html
                      • qtbluetooth-heartlistener-heartlistener-pro.html
                      • qtbluetooth-heartlistener-heartrate-cpp.html
                      • qtbluetooth-heartlistener-heartrate-h.html
                      • qtbluetooth-heartlistener-main-cpp.html
                      • qtbluetooth-heartlistener-resources-qrc.html
                      • qtbluetooth-heartrate-server-example.html
                      • qtbluetooth-heartrate-server-heartrate-server-pro.html
                      • qtbluetooth-heartrate-server-main-cpp.html
                      • qtbluetooth-index.html
                      • qtbluetooth-le-overview.html
                      • qtbluetooth-lowenergyscanner-assets-characteristics-qml.html
                      • qtbluetooth-lowenergyscanner-assets-dialog-qml.html
                      • qtbluetooth-lowenergyscanner-assets-header-qml.html
                      • qtbluetooth-lowenergyscanner-assets-label-qml.html
                      • qtbluetooth-lowenergyscanner-assets-main-qml.html
                      • qtbluetooth-lowenergyscanner-assets-menu-qml.html
                      • qtbluetooth-lowenergyscanner-assets-services-qml.html
                      • qtbluetooth-lowenergyscanner-characteristicinfo-cpp.html
                      • qtbluetooth-lowenergyscanner-characteristicinfo-h.html
                      • qtbluetooth-lowenergyscanner-device-cpp.html
                      • qtbluetooth-lowenergyscanner-device-h.html
                      • qtbluetooth-lowenergyscanner-deviceinfo-cpp.html
                      • qtbluetooth-lowenergyscanner-deviceinfo-h.html
                      • qtbluetooth-lowenergyscanner-example.html
                      • qtbluetooth-lowenergyscanner-lowenergyscanner-pro.html
                      • qtbluetooth-lowenergyscanner-main-cpp.html
                      • qtbluetooth-lowenergyscanner-resources-qrc.html
                      • qtbluetooth-lowenergyscanner-serviceinfo-cpp.html
                      • qtbluetooth-lowenergyscanner-serviceinfo-h.html
                      • qtbluetooth-module.html
                      • qtbluetooth-overview.html
                      • qtbluetooth-picturetransfer-bttransfer-qml.html
                      • qtbluetooth-picturetransfer-button-qml.html
                      • qtbluetooth-picturetransfer-devicediscovery-qml.html
                      • qtbluetooth-picturetransfer-example.html
                      • qtbluetooth-picturetransfer-filesending-qml.html
                      • qtbluetooth-picturetransfer-filetransfer-cpp.html
                      • qtbluetooth-picturetransfer-filetransfer-h.html
                      • qtbluetooth-picturetransfer-main-cpp.html
                      • qtbluetooth-picturetransfer-pictureselector-qml.html
                      • qtbluetooth-picturetransfer-picturetransfer-pro.html
                      • qtbluetooth-picturetransfer-qmltransfer-qrc.html
                      • qtbluetooth-pingpong-assets-board-qml.html
                      • qtbluetooth-pingpong-assets-dialog-qml.html
                      • qtbluetooth-pingpong-assets-main-qml.html
                      • qtbluetooth-pingpong-assets-menu-qml.html
                      • qtbluetooth-pingpong-example.html
                      • qtbluetooth-pingpong-main-cpp.html
                      • qtbluetooth-pingpong-pingpong-cpp.html
                      • qtbluetooth-pingpong-pingpong-h.html
                      • qtbluetooth-pingpong-pingpong-pro.html
                      • qtbluetooth-pingpong-resource-qrc.html
                      • qtbluetooth-qmlmodule.html
                      • qtbluetooth-scanner-button-qml.html
                      • qtbluetooth-scanner-example.html
                      • qtbluetooth-scanner-qmlscanner-cpp.html
                      • qtbluetooth-scanner-scanner-pro.html
                      • qtbluetooth-scanner-scanner-qml.html
                      • qtbluetooth-scanner-scanner-qrc.html
                      • qtbluetooth.index
                      • qtbluetooth.qhp
                      • qtbluetooth.qhp.sha1
                      • qtbluetooth.tags
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtcanvas3d.qch
                    • qtcanvas3d
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • cellphone-example.png
                        • framebuffer-example.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • interaction-example.png
                        • jsonmodels-example.png
                        • logo.png
                        • oneqt-example.png
                        • planets-example.jpg
                        • quickitemtexture-example.png
                        • textureandlight-example.png
                        • used-in-examples
                          • threejs
                            • cellphone
                              • images
                                • calendar.png
                                • camera.png
                                • clock.png
                                • contacts.png
                                • gallery.png
                                • games.png
                                • lock.png
                                • mail.png
                                • maps.png
                                • menu_background.jpg
                                • music.png
                                • plutomap1k.jpg
                                • qtlogo_with_alpha.png
                                • settings.png
                                • todo.png
                                • videos.png
                            • planets
                              • images
                                • earth.png
                                • earthbump1k.jpg
                                • earthcloudmapcolortrans.png
                                • earthmap1k.jpg
                                • earthspec1k.jpg
                                • galaxy_starfield.png
                                • jupiter.png
                                • jupitermap.jpg
                                • mars.png
                                • marsbump1k.jpg
                                • marsmap1k.jpg
                                • mercury.png
                                • mercurybump.jpg
                                • mercurymap.jpg
                                • moonbump1k.jpg
                                • moonmap1k.jpg
                                • neptune.png
                                • neptunemap.jpg
                                • plutobump1k.jpg
                                • plutomap1k.jpg
                                • saturn.png
                                • saturnmap.jpg
                                • saturnringcolortrans.png
                                • sun.png
                                • sunmap.jpg
                                • uranus.png
                                • uranusmap.jpg
                                • uranusringcolortrans.png
                                • venus.png
                                • venusbump.jpg
                                • venusmap.jpg
                      • qml-qtcanvas3d-canvas3d-members.html
                      • qml-qtcanvas3d-canvas3d.html
                      • qml-qtcanvas3d-canvas3dabstractobject-members.html
                      • qml-qtcanvas3d-canvas3dabstractobject.html
                      • qml-qtcanvas3d-canvas3dactiveinfo-members.html
                      • qml-qtcanvas3d-canvas3dactiveinfo.html
                      • qml-qtcanvas3d-canvas3dbuffer-members.html
                      • qml-qtcanvas3d-canvas3dbuffer.html
                      • qml-qtcanvas3d-canvas3dcontextattributes-members.html
                      • qml-qtcanvas3d-canvas3dcontextattributes.html
                      • qml-qtcanvas3d-canvas3dframebuffer-members.html
                      • qml-qtcanvas3d-canvas3dframebuffer.html
                      • qml-qtcanvas3d-canvas3dprogram-members.html
                      • qml-qtcanvas3d-canvas3dprogram.html
                      • qml-qtcanvas3d-canvas3drenderbuffer-members.html
                      • qml-qtcanvas3d-canvas3drenderbuffer.html
                      • qml-qtcanvas3d-canvas3dshader-members.html
                      • qml-qtcanvas3d-canvas3dshader.html
                      • qml-qtcanvas3d-canvas3dshaderprecisionformat-members.html
                      • qml-qtcanvas3d-canvas3dshaderprecisionformat.html
                      • qml-qtcanvas3d-canvas3dtexture-members.html
                      • qml-qtcanvas3d-canvas3dtexture.html
                      • qml-qtcanvas3d-canvas3dtextureprovider-members.html
                      • qml-qtcanvas3d-canvas3dtextureprovider.html
                      • qml-qtcanvas3d-canvas3duniformlocation-members.html
                      • qml-qtcanvas3d-canvas3duniformlocation.html
                      • qml-qtcanvas3d-context3d-members.html
                      • qml-qtcanvas3d-context3d.html
                      • qml-qtcanvas3d-glstatedumpext-members.html
                      • qml-qtcanvas3d-glstatedumpext.html
                      • qml-qtcanvas3d-textureimage-members.html
                      • qml-qtcanvas3d-textureimage.html
                      • qml-qtcanvas3d-textureimagefactory-members.html
                      • qml-qtcanvas3d-textureimagefactory.html
                      • qtcanvas3d-conformance-issues-html.html
                      • qtcanvas3d-examples.html
                      • qtcanvas3d-framebuffer-example.html
                      • qtcanvas3d-framebuffer-framebuffer-pro.html
                      • qtcanvas3d-framebuffer-framebuffer-qrc.html
                      • qtcanvas3d-framebuffer-main-cpp.html
                      • qtcanvas3d-framebuffer-qml-framebuffer-framebuffer-js.html
                      • qtcanvas3d-framebuffer-qml-framebuffer-main-qml.html
                      • qtcanvas3d-getting-started.html
                      • qtcanvas3d-index.html
                      • qtcanvas3d-interaction-example.html
                      • qtcanvas3d-interaction-interaction-pro.html
                      • qtcanvas3d-interaction-interaction-qrc.html
                      • qtcanvas3d-interaction-main-cpp.html
                      • qtcanvas3d-interaction-qml-interaction-interaction-js.html
                      • qtcanvas3d-interaction-qml-interaction-main-qml.html
                      • qtcanvas3d-jsonmodels-example.html
                      • qtcanvas3d-jsonmodels-jsonmodels-pro.html
                      • qtcanvas3d-jsonmodels-main-cpp.html
                      • qtcanvas3d-jsonmodels-qml-jsonmodels-jsonmodels-js.html
                      • qtcanvas3d-jsonmodels-qml-jsonmodels-jsonmodels-qml.html
                      • qtcanvas3d-jsonmodels-qml-qrc.html
                      • qtcanvas3d-logging.html
                      • qtcanvas3d-qmlmodule.html
                      • qtcanvas3d-quickitemtexture-example.html
                      • qtcanvas3d-quickitemtexture-main-cpp.html
                      • qtcanvas3d-quickitemtexture-qml-quickitemtexture-main-qml.html
                      • qtcanvas3d-quickitemtexture-qml-quickitemtexture-quickitemtexture-js.html
                      • qtcanvas3d-quickitemtexture-quickitemtexture-pro.html
                      • qtcanvas3d-quickitemtexture-quickitemtexture-qrc.html
                      • qtcanvas3d-textureandlight-example.html
                      • qtcanvas3d-textureandlight-main-cpp.html
                      • qtcanvas3d-textureandlight-qml-textureandlight-main-qml.html
                      • qtcanvas3d-textureandlight-qml-textureandlight-textureandlight-js.html
                      • qtcanvas3d-textureandlight-textureandlight-pro.html
                      • qtcanvas3d-textureandlight-textureandlight-qrc.html
                      • qtcanvas3d-threejs-cellphone-cellphone-pro.html
                      • qtcanvas3d-threejs-cellphone-cellphone-qrc.html
                      • qtcanvas3d-threejs-cellphone-example.html
                      • qtcanvas3d-threejs-cellphone-main-cpp.html
                      • qtcanvas3d-threejs-cellphone-qml-cellphone-cellphone-js.html
                      • qtcanvas3d-threejs-cellphone-qml-cellphone-cellphoneapp-qml.html
                      • qtcanvas3d-threejs-cellphone-qml-cellphone-cellphonecanvas-qml.html
                      • qtcanvas3d-threejs-cellphone-qml-cellphone-colorselector-qml.html
                      • qtcanvas3d-threejs-cellphone-qml-cellphone-fpsdisplay-qml.html
                      • qtcanvas3d-threejs-cellphone-qml-cellphone-main-qml.html
                      • qtcanvas3d-threejs-oneqt-example.html
                      • qtcanvas3d-threejs-oneqt-imagecube-js.html
                      • qtcanvas3d-threejs-oneqt-imagecube-qml.html
                      • qtcanvas3d-threejs-oneqt-infosheet-qml.html
                      • qtcanvas3d-threejs-oneqt-main-cpp.html
                      • qtcanvas3d-threejs-oneqt-navibutton-qml.html
                      • qtcanvas3d-threejs-oneqt-oneqt-pro.html
                      • qtcanvas3d-threejs-oneqt-oneqt-qml.html
                      • qtcanvas3d-threejs-oneqt-oneqt-qrc.html
                      • qtcanvas3d-threejs-oneqt-swipearea-qml.html
                      • qtcanvas3d-threejs-planets-example.html
                      • qtcanvas3d-threejs-planets-fpsdisplay-qml.html
                      • qtcanvas3d-threejs-planets-infosheet-qml.html
                      • qtcanvas3d-threejs-planets-main-cpp.html
                      • qtcanvas3d-threejs-planets-planetbutton-qml.html
                      • qtcanvas3d-threejs-planets-planets-js.html
                      • qtcanvas3d-threejs-planets-planets-pro.html
                      • qtcanvas3d-threejs-planets-planets-qml.html
                      • qtcanvas3d-threejs-planets-planets-qrc.html
                      • qtcanvas3d-threejs-planets-styledslider-qml.html
                      • qtcanvas3d.index
                      • qtcanvas3d.qhp
                      • qtcanvas3d.qhp.sha1
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtcharts.qch
                    • qtcharts
                      • charts-examples.html
                      • examples-manifest.xml
                      • images
                        • api_category_axis.png
                        • api_datatime_axis.png
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • examples_areachart.png
                        • examples_audio.png
                        • examples_barchart.png
                        • examples_barmodelmapper.png
                        • examples_boxplotchart.png
                        • examples_callout.png
                        • examples_chartthemes_blue_cerulean.png
                        • examples_chartthemes_brown_sand.png
                        • examples_chartthemes_light.png
                        • examples_customchart.png
                        • examples_datetimeaxis.png
                        • examples_donutbreakdown.png
                        • examples_donutchart.png
                        • examples_dynamicspline1.png
                        • examples_dynamicspline2.png
                        • examples_horizontalbarchart.png
                        • examples_horizontalpercentbarchart.png
                        • examples_horizontalstackedbarchart.png
                        • examples_legendmarkers.png
                        • examples_legend_detach.png
                        • examples_legend_detach2.png
                        • examples_lineandbar.png
                        • examples_linechart.png
                        • examples_logvalueaxis.png
                        • examples_modeldata.png
                        • examples_multiaxis.png
                        • examples_nesteddonuts.png
                        • examples_openglseries.png
                        • examples_percentbarchart.png
                        • examples_percentbarchart_legend.png
                        • examples_piechart.png
                        • examples_piechartdrill1.png
                        • examples_piechartdrill2.png
                        • examples_polarchart.png
                        • examples_qmlaxes1.png
                        • examples_qmlaxes2.png
                        • examples_qmlaxes3.png
                        • examples_qmlboxplot.png
                        • examples_qmlchart1.png
                        • examples_qmlchart10.png
                        • examples_qmlchart11.png
                        • examples_qmlchart12.png
                        • examples_qmlchart2.png
                        • examples_qmlchart3.png
                        • examples_qmlchart4.png
                        • examples_qmlchart5.png
                        • examples_qmlchart6.png
                        • examples_qmlchart7.png
                        • examples_qmlchart8.png
                        • examples_qmlchart9.png
                        • examples_qmlcustomizations.png
                        • examples_qmlcustomlegend1.png
                        • examples_qmlcustomlegend2.png
                        • examples_qmlcustomlegend3.png
                        • examples_qmlf1legends.png
                        • examples_qmloscilloscope.png
                        • examples_qmlpiechart.png
                        • examples_qmlpolarchart1.png
                        • examples_qmlpolarchart2.png
                        • examples_qmlpolarchart3.png
                        • examples_qmlweather.png
                        • examples_scatterchart.png
                        • examples_scatterinteractions.png
                        • examples_splinechart.png
                        • examples_stackedbarchart.png
                        • examples_stackedbarchartdrilldown1.png
                        • examples_stackedbarchartdrilldown2.png
                        • examples_temperaturerecords.png
                        • examples_zoomlinechart1.png
                        • examples_zoomlinechart2.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • piechart_customization.png
                      • qabstractaxis-members.html
                      • qabstractaxis.html
                      • qabstractbarseries-members.html
                      • qabstractbarseries.html
                      • qabstractseries-members.html
                      • qabstractseries.html
                      • qarealegendmarker-members.html
                      • qarealegendmarker.html
                      • qareaseries-members.html
                      • qareaseries.html
                      • qbarcategoryaxis-members.html
                      • qbarcategoryaxis.html
                      • qbarlegendmarker-members.html
                      • qbarlegendmarker.html
                      • qbarseries-members.html
                      • qbarseries.html
                      • qbarset-members.html
                      • qbarset.html
                      • qboxplotlegendmarker-members.html
                      • qboxplotlegendmarker.html
                      • qboxplotseries-members.html
                      • qboxplotseries.html
                      • qboxset-members.html
                      • qboxset.html
                      • qcategoryaxis-members.html
                      • qcategoryaxis.html
                      • qchart-members.html
                      • qchart.html
                      • qchartview-members.html
                      • qchartview.html
                      • qdatetimeaxis-members.html
                      • qdatetimeaxis.html
                      • qhbarmodelmapper-members.html
                      • qhbarmodelmapper.html
                      • qhorizontalbarseries-members.html
                      • qhorizontalbarseries.html
                      • qhorizontalpercentbarseries-members.html
                      • qhorizontalpercentbarseries.html
                      • qhorizontalstackedbarseries-members.html
                      • qhorizontalstackedbarseries.html
                      • qhpiemodelmapper-members.html
                      • qhpiemodelmapper.html
                      • qhxymodelmapper-members.html
                      • qhxymodelmapper.html
                      • qlegend-members.html
                      • qlegend.html
                      • qlegendmarker-members.html
                      • qlegendmarker.html
                      • qlineseries-members.html
                      • qlineseries.html
                      • qlogvalueaxis-members.html
                      • qlogvalueaxis.html
                      • qml-qtcharts-abstractaxis-members.html
                      • qml-qtcharts-abstractaxis.html
                      • qml-qtcharts-abstractbarseries-members.html
                      • qml-qtcharts-abstractbarseries.html
                      • qml-qtcharts-abstractseries-members.html
                      • qml-qtcharts-abstractseries.html
                      • qml-qtcharts-areaseries-members.html
                      • qml-qtcharts-areaseries.html
                      • qml-qtcharts-barcategoryaxis-members.html
                      • qml-qtcharts-barcategoryaxis.html
                      • qml-qtcharts-barseries-members.html
                      • qml-qtcharts-barseries.html
                      • qml-qtcharts-barset-members.html
                      • qml-qtcharts-barset.html
                      • qml-qtcharts-boxplotseries-members.html
                      • qml-qtcharts-boxplotseries.html
                      • qml-qtcharts-boxset-members.html
                      • qml-qtcharts-boxset.html
                      • qml-qtcharts-categoryaxis-members.html
                      • qml-qtcharts-categoryaxis.html
                      • qml-qtcharts-categoryrange-members.html
                      • qml-qtcharts-categoryrange.html
                      • qml-qtcharts-chartview-members.html
                      • qml-qtcharts-chartview.html
                      • qml-qtcharts-datetimeaxis-members.html
                      • qml-qtcharts-datetimeaxis.html
                      • qml-qtcharts-hbarmodelmapper-members.html
                      • qml-qtcharts-hbarmodelmapper.html
                      • qml-qtcharts-horizontalbarseries-members.html
                      • qml-qtcharts-horizontalbarseries.html
                      • qml-qtcharts-horizontalpercentbarseries-members.html
                      • qml-qtcharts-horizontalpercentbarseries.html
                      • qml-qtcharts-horizontalstackedbarseries-members.html
                      • qml-qtcharts-horizontalstackedbarseries.html
                      • qml-qtcharts-hpiemodelmapper-members.html
                      • qml-qtcharts-hpiemodelmapper.html
                      • qml-qtcharts-hxymodelmapper-members.html
                      • qml-qtcharts-hxymodelmapper.html
                      • qml-qtcharts-legend-members.html
                      • qml-qtcharts-legend.html
                      • qml-qtcharts-lineseries-members.html
                      • qml-qtcharts-lineseries.html
                      • qml-qtcharts-logvalueaxis-members.html
                      • qml-qtcharts-logvalueaxis.html
                      • qml-qtcharts-margins-members.html
                      • qml-qtcharts-margins.html
                      • qml-qtcharts-percentbarseries-members.html
                      • qml-qtcharts-percentbarseries.html
                      • qml-qtcharts-pieseries-members.html
                      • qml-qtcharts-pieseries.html
                      • qml-qtcharts-pieslice-members.html
                      • qml-qtcharts-pieslice.html
                      • qml-qtcharts-polarchartview-members.html
                      • qml-qtcharts-polarchartview.html
                      • qml-qtcharts-scatterseries-members.html
                      • qml-qtcharts-scatterseries.html
                      • qml-qtcharts-splineseries-members.html
                      • qml-qtcharts-splineseries.html
                      • qml-qtcharts-stackedbarseries-members.html
                      • qml-qtcharts-stackedbarseries.html
                      • qml-qtcharts-valueaxis-members.html
                      • qml-qtcharts-valueaxis.html
                      • qml-qtcharts-vbarmodelmapper-members.html
                      • qml-qtcharts-vbarmodelmapper.html
                      • qml-qtcharts-vboxplotmodelmapper-members.html
                      • qml-qtcharts-vboxplotmodelmapper.html
                      • qml-qtcharts-vpiemodelmapper-members.html
                      • qml-qtcharts-vpiemodelmapper.html
                      • qml-qtcharts-vxymodelmapper-members.html
                      • qml-qtcharts-vxymodelmapper.html
                      • qml-qtcharts-xypoint-members.html
                      • qml-qtcharts-xypoint.html
                      • qml-qtcharts-xyseries-members.html
                      • qml-qtcharts-xyseries.html
                      • qpercentbarseries-members.html
                      • qpercentbarseries.html
                      • qpielegendmarker-members.html
                      • qpielegendmarker.html
                      • qpieseries-members.html
                      • qpieseries.html
                      • qpieslice-members.html
                      • qpieslice.html
                      • qpolarchart-members.html
                      • qpolarchart.html
                      • qscatterseries-members.html
                      • qscatterseries.html
                      • qsplineseries-members.html
                      • qsplineseries.html
                      • qstackedbarseries-members.html
                      • qstackedbarseries.html
                      • qt-charts-module.html
                      • qtcharts-areachart-areachart-pro.html
                      • qtcharts-areachart-example.html
                      • qtcharts-areachart-main-cpp.html
                      • qtcharts-audio-audio-pro.html
                      • qtcharts-audio-example.html
                      • qtcharts-audio-main-cpp.html
                      • qtcharts-audio-widget-cpp.html
                      • qtcharts-audio-widget-h.html
                      • qtcharts-audio-xyseriesiodevice-cpp.html
                      • qtcharts-audio-xyseriesiodevice-h.html
                      • qtcharts-barchart-barchart-pro.html
                      • qtcharts-barchart-example.html
                      • qtcharts-barchart-main-cpp.html
                      • qtcharts-barmodelmapper-barmodelmapper-pro.html
                      • qtcharts-barmodelmapper-customtablemodel-cpp.html
                      • qtcharts-barmodelmapper-customtablemodel-h.html
                      • qtcharts-barmodelmapper-example.html
                      • qtcharts-barmodelmapper-main-cpp.html
                      • qtcharts-barmodelmapper-tablewidget-cpp.html
                      • qtcharts-barmodelmapper-tablewidget-h.html
                      • qtcharts-boxplotchart-boxdatareader-cpp.html
                      • qtcharts-boxplotchart-boxdatareader-h.html
                      • qtcharts-boxplotchart-boxplotchart-pro.html
                      • qtcharts-boxplotchart-boxplotdata-qrc.html
                      • qtcharts-boxplotchart-example.html
                      • qtcharts-boxplotchart-main-cpp.html
                      • qtcharts-callout-callout-cpp.html
                      • qtcharts-callout-callout-h.html
                      • qtcharts-callout-callout-pro.html
                      • qtcharts-callout-example.html
                      • qtcharts-callout-main-cpp.html
                      • qtcharts-callout-view-cpp.html
                      • qtcharts-callout-view-h.html
                      • qtcharts-chartthemes-chartthemes-pro.html
                      • qtcharts-chartthemes-example.html
                      • qtcharts-chartthemes-main-cpp.html
                      • qtcharts-chartthemes-themewidget-cpp.html
                      • qtcharts-chartthemes-themewidget-h.html
                      • qtcharts-customchart-customchart-pro.html
                      • qtcharts-customchart-example.html
                      • qtcharts-customchart-main-cpp.html
                      • qtcharts-datetimeaxis-datetimeaxis-pro.html
                      • qtcharts-datetimeaxis-example.html
                      • qtcharts-datetimeaxis-main-cpp.html
                      • qtcharts-datetimeaxis-sundata-qrc.html
                      • qtcharts-donutbreakdown-donutbreakdown-pro.html
                      • qtcharts-donutbreakdown-donutbreakdownchart-cpp.html
                      • qtcharts-donutbreakdown-donutbreakdownchart-h.html
                      • qtcharts-donutbreakdown-example.html
                      • qtcharts-donutbreakdown-main-cpp.html
                      • qtcharts-donutbreakdown-mainslice-cpp.html
                      • qtcharts-donutbreakdown-mainslice-h.html
                      • qtcharts-donutchart-donutchart-pro.html
                      • qtcharts-donutchart-example.html
                      • qtcharts-donutchart-main-cpp.html
                      • qtcharts-dynamicspline-chart-cpp.html
                      • qtcharts-dynamicspline-chart-h.html
                      • qtcharts-dynamicspline-dynamicspline-pro.html
                      • qtcharts-dynamicspline-example.html
                      • qtcharts-dynamicspline-main-cpp.html
                      • qtcharts-horizontalbarchart-example.html
                      • qtcharts-horizontalbarchart-horizontalbarchart-pro.html
                      • qtcharts-horizontalbarchart-main-cpp.html
                      • qtcharts-horizontalpercentbarchart-example.html
                      • qtcharts-horizontalpercentbarchart-horizontalpercentbarchart-pro.html
                      • qtcharts-horizontalpercentbarchart-main-cpp.html
                      • qtcharts-horizontalstackedbarchart-example.html
                      • qtcharts-horizontalstackedbarchart-horizontalstackedbarchart-pro.html
                      • qtcharts-horizontalstackedbarchart-main-cpp.html
                      • qtcharts-index.html
                      • qtcharts-legend-example.html
                      • qtcharts-legend-legend-pro.html
                      • qtcharts-legend-main-cpp.html
                      • qtcharts-legend-mainwidget-cpp.html
                      • qtcharts-legend-mainwidget-h.html
                      • qtcharts-legendmarkers-example.html
                      • qtcharts-legendmarkers-legendmarkers-pro.html
                      • qtcharts-legendmarkers-main-cpp.html
                      • qtcharts-legendmarkers-mainwidget-cpp.html
                      • qtcharts-legendmarkers-mainwidget-h.html
                      • qtcharts-lineandbar-example.html
                      • qtcharts-lineandbar-lineandbar-pro.html
                      • qtcharts-lineandbar-main-cpp.html
                      • qtcharts-linechart-example.html
                      • qtcharts-linechart-linechart-pro.html
                      • qtcharts-linechart-main-cpp.html
                      • qtcharts-logvalueaxis-example.html
                      • qtcharts-logvalueaxis-logvalueaxis-pro.html
                      • qtcharts-logvalueaxis-main-cpp.html
                      • qtcharts-modeldata-customtablemodel-cpp.html
                      • qtcharts-modeldata-customtablemodel-h.html
                      • qtcharts-modeldata-example.html
                      • qtcharts-modeldata-main-cpp.html
                      • qtcharts-modeldata-modeldata-pro.html
                      • qtcharts-modeldata-tablewidget-cpp.html
                      • qtcharts-modeldata-tablewidget-h.html
                      • qtcharts-multiaxis-example.html
                      • qtcharts-multiaxis-main-cpp.html
                      • qtcharts-multiaxis-multiaxis-pro.html
                      • qtcharts-nesteddonuts-example.html
                      • qtcharts-nesteddonuts-main-cpp.html
                      • qtcharts-nesteddonuts-nesteddonuts-pro.html
                      • qtcharts-nesteddonuts-widget-cpp.html
                      • qtcharts-nesteddonuts-widget-h.html
                      • qtcharts-openglseries-datasource-cpp.html
                      • qtcharts-openglseries-datasource-h.html
                      • qtcharts-openglseries-example.html
                      • qtcharts-openglseries-main-cpp.html
                      • qtcharts-openglseries-openglseries-pro.html
                      • qtcharts-percentbarchart-example.html
                      • qtcharts-percentbarchart-main-cpp.html
                      • qtcharts-percentbarchart-percentbarchart-pro.html
                      • qtcharts-piechart-example.html
                      • qtcharts-piechart-main-cpp.html
                      • qtcharts-piechart-piechart-pro.html
                      • qtcharts-piechartcustomization-brushtool-cpp.html
                      • qtcharts-piechartcustomization-brushtool-h.html
                      • qtcharts-piechartcustomization-customslice-cpp.html
                      • qtcharts-piechartcustomization-customslice-h.html
                      • qtcharts-piechartcustomization-example.html
                      • qtcharts-piechartcustomization-main-cpp.html
                      • qtcharts-piechartcustomization-mainwidget-cpp.html
                      • qtcharts-piechartcustomization-mainwidget-h.html
                      • qtcharts-piechartcustomization-pentool-cpp.html
                      • qtcharts-piechartcustomization-pentool-h.html
                      • qtcharts-piechartcustomization-piechartcustomization-pro.html
                      • qtcharts-piechartdrilldown-drilldownchart-cpp.html
                      • qtcharts-piechartdrilldown-drilldownchart-h.html
                      • qtcharts-piechartdrilldown-drilldownslice-cpp.html
                      • qtcharts-piechartdrilldown-drilldownslice-h.html
                      • qtcharts-piechartdrilldown-example.html
                      • qtcharts-piechartdrilldown-main-cpp.html
                      • qtcharts-piechartdrilldown-piechartdrilldown-pro.html
                      • qtcharts-polarchart-chartview-cpp.html
                      • qtcharts-polarchart-chartview-h.html
                      • qtcharts-polarchart-example.html
                      • qtcharts-polarchart-main-cpp.html
                      • qtcharts-polarchart-polarchart-pro.html
                      • qtcharts-qmlaxes-example.html
                      • qtcharts-qmlaxes-main-cpp.html
                      • qtcharts-qmlaxes-qml-qmlaxes-main-qml.html
                      • qtcharts-qmlaxes-qml-qmlaxes-view1-qml.html
                      • qtcharts-qmlaxes-qml-qmlaxes-view2-qml.html
                      • qtcharts-qmlaxes-qml-qmlaxes-view3-qml.html
                      • qtcharts-qmlaxes-qmlaxes-pro.html
                      • qtcharts-qmlaxes-resources-qrc.html
                      • qtcharts-qmlchart-example.html
                      • qtcharts-qmlchart-main-cpp.html
                      • qtcharts-qmlchart-qml-qmlchart-main-qml.html
                      • qtcharts-qmlchart-qml-qmlchart-view1-qml.html
                      • qtcharts-qmlchart-qml-qmlchart-view10-qml.html
                      • qtcharts-qmlchart-qml-qmlchart-view11-qml.html
                      • qtcharts-qmlchart-qml-qmlchart-view12-qml.html
                      • qtcharts-qmlchart-qml-qmlchart-view2-qml.html
                      • qtcharts-qmlchart-qml-qmlchart-view3-qml.html
                      • qtcharts-qmlchart-qml-qmlchart-view4-qml.html
                      • qtcharts-qmlchart-qml-qmlchart-view5-qml.html
                      • qtcharts-qmlchart-qml-qmlchart-view6-qml.html
                      • qtcharts-qmlchart-qml-qmlchart-view7-qml.html
                      • qtcharts-qmlchart-qml-qmlchart-view8-qml.html
                      • qtcharts-qmlchart-qml-qmlchart-view9-qml.html
                      • qtcharts-qmlchart-qmlchart-pro.html
                      • qtcharts-qmlchart-resources-qrc.html
                      • qtcharts-qmlcustomizations-example.html
                      • qtcharts-qmlcustomizations-main-cpp.html
                      • qtcharts-qmlcustomizations-qml-qmlcustomizations-main-qml.html
                      • qtcharts-qmlcustomizations-qmlcustomizations-pro.html
                      • qtcharts-qmlcustomizations-resources-qrc.html
                      • qtcharts-qmlcustomlegend-example.html
                      • qtcharts-qmlcustomlegend-main-cpp.html
                      • qtcharts-qmlcustomlegend-qml-qmlcustomlegend-animatedareaseries-qml.html
                      • qtcharts-qmlcustomlegend-qml-qmlcustomlegend-chartviewhighlighted-qml.html
                      • qtcharts-qmlcustomlegend-qml-qmlcustomlegend-chartviewselector-qml.html
                      • qtcharts-qmlcustomlegend-qml-qmlcustomlegend-chartviewstacked-qml.html
                      • qtcharts-qmlcustomlegend-qml-qmlcustomlegend-customlegend-qml.html
                      • qtcharts-qmlcustomlegend-qml-qmlcustomlegend-main-qml.html
                      • qtcharts-qmlcustomlegend-qmlcustomlegend-pro.html
                      • qtcharts-qmlcustomlegend-resources-qrc.html
                      • qtcharts-qmlf1legends-example.html
                      • qtcharts-qmlf1legends-main-cpp.html
                      • qtcharts-qmlf1legends-qml-qmlf1legends-main-qml.html
                      • qtcharts-qmlf1legends-qml-qmlf1legends-speedsxml-qml.html
                      • qtcharts-qmlf1legends-qmlf1legends-pro.html
                      • qtcharts-qmlf1legends-resources-qrc.html
                      • qtcharts-qmlmodule.html
                      • qtcharts-qmloscilloscope-datasource-cpp.html
                      • qtcharts-qmloscilloscope-datasource-h.html
                      • qtcharts-qmloscilloscope-example.html
                      • qtcharts-qmloscilloscope-main-cpp.html
                      • qtcharts-qmloscilloscope-qml-qmloscilloscope-controlpanel-qml.html
                      • qtcharts-qmloscilloscope-qml-qmloscilloscope-main-qml.html
                      • qtcharts-qmloscilloscope-qml-qmloscilloscope-multibutton-qml.html
                      • qtcharts-qmloscilloscope-qml-qmloscilloscope-scopeview-qml.html
                      • qtcharts-qmloscilloscope-qmloscilloscope-pro.html
                      • qtcharts-qmloscilloscope-resources-qrc.html
                      • qtcharts-qmlpolarchart-example.html
                      • qtcharts-qmlpolarchart-main-cpp.html
                      • qtcharts-qmlpolarchart-qml-qmlpolarchart-main-qml.html
                      • qtcharts-qmlpolarchart-qml-qmlpolarchart-view1-qml.html
                      • qtcharts-qmlpolarchart-qml-qmlpolarchart-view2-qml.html
                      • qtcharts-qmlpolarchart-qml-qmlpolarchart-view3-qml.html
                      • qtcharts-qmlpolarchart-qmlpolarchart-pro.html
                      • qtcharts-qmlpolarchart-resources-qrc.html
                      • qtcharts-qmlweather-example.html
                      • qtcharts-qmlweather-main-cpp.html
                      • qtcharts-qmlweather-qml-qmlweather-main-qml.html
                      • qtcharts-qmlweather-qmlweather-pro.html
                      • qtcharts-qmlweather-resources-qrc.html
                      • qtcharts-scatterchart-chartview-cpp.html
                      • qtcharts-scatterchart-chartview-h.html
                      • qtcharts-scatterchart-example.html
                      • qtcharts-scatterchart-main-cpp.html
                      • qtcharts-scatterchart-scatterchart-pro.html
                      • qtcharts-scatterinteractions-chartview-cpp.html
                      • qtcharts-scatterinteractions-chartview-h.html
                      • qtcharts-scatterinteractions-example.html
                      • qtcharts-scatterinteractions-main-cpp.html
                      • qtcharts-scatterinteractions-scatterinteractions-pro.html
                      • qtcharts-splinechart-example.html
                      • qtcharts-splinechart-main-cpp.html
                      • qtcharts-splinechart-splinechart-pro.html
                      • qtcharts-stackedbarchart-example.html
                      • qtcharts-stackedbarchart-main-cpp.html
                      • qtcharts-stackedbarchart-stackedbarchart-pro.html
                      • qtcharts-stackedbarchartdrilldown-drilldownchart-cpp.html
                      • qtcharts-stackedbarchartdrilldown-drilldownchart-h.html
                      • qtcharts-stackedbarchartdrilldown-drilldownseries-cpp.html
                      • qtcharts-stackedbarchartdrilldown-drilldownseries-h.html
                      • qtcharts-stackedbarchartdrilldown-example.html
                      • qtcharts-stackedbarchartdrilldown-main-cpp.html
                      • qtcharts-stackedbarchartdrilldown-stackedbarchartdrilldown-pro.html
                      • qtcharts-temperaturerecords-example.html
                      • qtcharts-temperaturerecords-main-cpp.html
                      • qtcharts-temperaturerecords-temperaturerecords-pro.html
                      • qtcharts-zoomlinechart-chart-cpp.html
                      • qtcharts-zoomlinechart-chart-h.html
                      • qtcharts-zoomlinechart-chartview-cpp.html
                      • qtcharts-zoomlinechart-chartview-h.html
                      • qtcharts-zoomlinechart-example.html
                      • qtcharts-zoomlinechart-main-cpp.html
                      • qtcharts-zoomlinechart-zoomlinechart-pro.html
                      • qtcharts.index
                      • qtcharts.qhp
                      • qtcharts.qhp.sha1
                      • qvalueaxis-members.html
                      • qvalueaxis.html
                      • qvbarmodelmapper-members.html
                      • qvbarmodelmapper.html
                      • qvboxplotmodelmapper-members.html
                      • qvboxplotmodelmapper.html
                      • qvpiemodelmapper-members.html
                      • qvpiemodelmapper.html
                      • qvxymodelmapper-members.html
                      • qvxymodelmapper.html
                      • qxylegendmarker-members.html
                      • qxylegendmarker.html
                      • qxyseries-members.html
                      • qxyseries.html
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtconcurrent.qch
                    • qtconcurrent
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • imagescaling_example.png
                        • logo.png
                        • qtconcurrent-progressdialog.png
                      • qtconcurrent-imagescaling-example.html
                      • qtconcurrent-imagescaling-imagescaling-cpp.html
                      • qtconcurrent-imagescaling-imagescaling-h.html
                      • qtconcurrent-imagescaling-imagescaling-pro.html
                      • qtconcurrent-imagescaling-main-cpp.html
                      • qtconcurrent-index.html
                      • qtconcurrent-map-example.html
                      • qtconcurrent-map-main-cpp.html
                      • qtconcurrent-map-map-pro.html
                      • qtconcurrent-module.html
                      • qtconcurrent-obsolete.html
                      • qtconcurrent-progressdialog-example.html
                      • qtconcurrent-progressdialog-main-cpp.html
                      • qtconcurrent-progressdialog-progressdialog-pro.html
                      • qtconcurrent-runfunction-example.html
                      • qtconcurrent-runfunction-main-cpp.html
                      • qtconcurrent-runfunction-runfunction-pro.html
                      • qtconcurrent-wordcount-example.html
                      • qtconcurrent-wordcount-main-cpp.html
                      • qtconcurrent-wordcount-wordcount-pro.html
                      • qtconcurrent.html
                      • qtconcurrent.index
                      • qtconcurrent.qhp
                      • qtconcurrent.qhp.sha1
                      • qtconcurrent.tags
                      • qtconcurrentfilter.html
                      • qtconcurrentmap.html
                      • qtconcurrentrun.html
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtcore.qch
                    • qtcore
                      • animation-overview.html
                      • animation.html
                      • codec-big5.html
                      • codec-big5hkscs.html
                      • codec-eucjp.html
                      • codec-euckr.html
                      • codec-gbk.html
                      • codec-sjis.html
                      • codec-tscii.html
                      • codecs-jis.html
                      • containers.html
                      • custom-types.html
                      • datastreamformat.html
                      • events.html
                      • eventsandfilters.html
                      • examples-manifest.xml
                      • images
                        • abstract-connections.png
                        • animations-architecture.png
                        • arrow_bc.png
                        • bgrContent.png
                        • brush-styles.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • cursor-arrow.png
                        • cursor-busy.png
                        • cursor-closedhand.png
                        • cursor-cross.png
                        • cursor-forbidden.png
                        • cursor-hand.png
                        • cursor-hsplit.png
                        • cursor-ibeam.png
                        • cursor-openhand.png
                        • cursor-sizeall.png
                        • cursor-sizeb.png
                        • cursor-sizef.png
                        • cursor-sizeh.png
                        • cursor-sizev.png
                        • cursor-uparrow.png
                        • cursor-vsplit.png
                        • cursor-wait.png
                        • cursor-whatsthis.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • javaiterators1.png
                        • javaiterators2.png
                        • localfortuneclient-example.png
                        • localfortuneserver-example.png
                        • logo.png
                        • mandelbrot-example.png
                        • mandelbrot_scroll1.png
                        • mandelbrot_scroll2.png
                        • mandelbrot_scroll3.png
                        • mandelbrot_zoom1.png
                        • mandelbrot_zoom2.png
                        • mandelbrot_zoom3.png
                        • mimetypebrowser.png
                        • modelindex-no-parent.png
                        • modelview-begin-append-columns.png
                        • modelview-begin-append-rows.png
                        • modelview-begin-insert-columns.png
                        • modelview-begin-insert-rows.png
                        • modelview-begin-remove-columns.png
                        • modelview-begin-remove-rows.png
                        • modelview-move-rows-1.png
                        • modelview-move-rows-2.png
                        • modelview-move-rows-3.png
                        • modelview-move-rows-4.png
                        • qeasingcurve-inback.png
                        • qeasingcurve-inbounce.png
                        • qeasingcurve-incirc.png
                        • qeasingcurve-incubic.png
                        • qeasingcurve-inelastic.png
                        • qeasingcurve-inexpo.png
                        • qeasingcurve-inoutback.png
                        • qeasingcurve-inoutbounce.png
                        • qeasingcurve-inoutcirc.png
                        • qeasingcurve-inoutcubic.png
                        • qeasingcurve-inoutelastic.png
                        • qeasingcurve-inoutexpo.png
                        • qeasingcurve-inoutquad.png
                        • qeasingcurve-inoutquart.png
                        • qeasingcurve-inoutquint.png
                        • qeasingcurve-inoutsine.png
                        • qeasingcurve-inquad.png
                        • qeasingcurve-inquart.png
                        • qeasingcurve-inquint.png
                        • qeasingcurve-insine.png
                        • qeasingcurve-linear.png
                        • qeasingcurve-outback.png
                        • qeasingcurve-outbounce.png
                        • qeasingcurve-outcirc.png
                        • qeasingcurve-outcubic.png
                        • qeasingcurve-outelastic.png
                        • qeasingcurve-outexpo.png
                        • qeasingcurve-outinback.png
                        • qeasingcurve-outinbounce.png
                        • qeasingcurve-outincirc.png
                        • qeasingcurve-outincubic.png
                        • qeasingcurve-outinelastic.png
                        • qeasingcurve-outinexpo.png
                        • qeasingcurve-outinquad.png
                        • qeasingcurve-outinquart.png
                        • qeasingcurve-outinquint.png
                        • qeasingcurve-outinsine.png
                        • qeasingcurve-outquad.png
                        • qeasingcurve-outquart.png
                        • qeasingcurve-outquint.png
                        • qeasingcurve-outsine.png
                        • qimage-scaling.png
                        • qline-coordinates.png
                        • qline-point.png
                        • qlinef-angle-identicaldirection.png
                        • qlinef-angle-oppositedirection.png
                        • qlinef-bounded.png
                        • qlinef-normalvector.png
                        • qlinef-unbounded.png
                        • qpen-bevel.png
                        • qpen-custom.png
                        • qpen-dash.png
                        • qpen-dashdot.png
                        • qpen-dashdotdot.png
                        • qpen-dot.png
                        • qpen-flat.png
                        • qpen-miter.png
                        • qpen-roundcap.png
                        • qpen-roundjoin.png
                        • qpen-solid.png
                        • qpen-square.png
                        • qrect-coordinates.png
                        • qrect-diagram-one.png
                        • qrect-diagram-three.png
                        • qrect-diagram-two.png
                        • qrect-diagram-zero.png
                        • qrect-intersect.png
                        • qrect-unite.png
                        • qrectf-coordinates.png
                        • qrectf-diagram-one.png
                        • qrectf-diagram-three.png
                        • qrectf-diagram-two.png
                        • qsortfilterproxymodel-sorting.png
                        • queuedcustomtype-example.png
                        • qurl-authority.png
                        • qurl-authority2.png
                        • qurl-authority3.png
                        • qurl-fragment.png
                        • qurl-ftppath.png
                        • qurl-mailtopath.png
                        • qurl-querystring.png
                        • resources.png
                        • sharedmemory-example_1.png
                        • sharedmemory-example_2.png
                        • statemachine-button-history.png
                        • statemachine-button-nested.png
                        • statemachine-button.png
                        • statemachine-customevents.png
                        • statemachine-customevents2.png
                        • statemachine-finished.png
                        • statemachine-nonparallel.png
                        • statemachine-parallel.png
                        • stliterators1.png
                      • implicit-sharing.html
                      • io-functions.html
                      • io.html
                      • json.html
                      • metaobjects.html
                      • object.html
                      • objecttrees.html
                      • plugins.html
                      • properties.html
                      • qabstractanimation-members.html
                      • qabstractanimation.html
                      • qabstracteventdispatcher-members.html
                      • qabstracteventdispatcher-obsolete.html
                      • qabstracteventdispatcher-timerinfo-members.html
                      • qabstracteventdispatcher-timerinfo.html
                      • qabstracteventdispatcher.html
                      • qabstractitemmodel-members.html
                      • qabstractitemmodel-obsolete.html
                      • qabstractitemmodel.html
                      • qabstractlistmodel-members.html
                      • qabstractlistmodel.html
                      • qabstractnativeeventfilter-members.html
                      • qabstractnativeeventfilter.html
                      • qabstractproxymodel-members.html
                      • qabstractproxymodel.html
                      • qabstractstate-members.html
                      • qabstractstate.html
                      • qabstracttablemodel-members.html
                      • qabstracttablemodel.html
                      • qabstracttransition-members.html
                      • qabstracttransition.html
                      • qanimationgroup-members.html
                      • qanimationgroup.html
                      • qassociativeiterable-const-iterator-members.html
                      • qassociativeiterable-const-iterator.html
                      • qassociativeiterable-members.html
                      • qassociativeiterable.html
                      • qatomicint-members.html
                      • qatomicint.html
                      • qatomicinteger-members.html
                      • qatomicinteger.html
                      • qatomicpointer-members.html
                      • qatomicpointer.html
                      • qbasictimer-members.html
                      • qbasictimer.html
                      • qbitarray-members.html
                      • qbitarray.html
                      • qbuffer-members.html
                      • qbuffer.html
                      • qbytearray-members.html
                      • qbytearray-obsolete.html
                      • qbytearray.html
                      • qbytearraylist-members.html
                      • qbytearraylist.html
                      • qbytearraymatcher-members.html
                      • qbytearraymatcher.html
                      • qcache-members.html
                      • qcache.html
                      • qchar-members.html
                      • qchar-obsolete.html
                      • qchar.html
                      • qchildevent-members.html
                      • qchildevent.html
                      • qcollator-members.html
                      • qcollator.html
                      • qcollatorsortkey-members.html
                      • qcollatorsortkey.html
                      • qcommandlineoption-members.html
                      • qcommandlineoption.html
                      • qcommandlineparser-members.html
                      • qcommandlineparser.html
                      • qcontiguouscache-members.html
                      • qcontiguouscache.html
                      • qcoreapplication-members.html
                      • qcoreapplication-obsolete.html
                      • qcoreapplication.html
                      • qcryptographichash-members.html
                      • qcryptographichash.html
                      • qdatastream-members.html
                      • qdatastream-obsolete.html
                      • qdatastream.html
                      • qdate-members.html
                      • qdate-obsolete.html
                      • qdate.html
                      • qdatetime-members.html
                      • qdatetime.html
                      • qdebug-members.html
                      • qdebug.html
                      • qdebugstatesaver-members.html
                      • qdebugstatesaver.html
                      • qdir-members.html
                      • qdir-obsolete.html
                      • qdir.html
                      • qdiriterator-members.html
                      • qdiriterator.html
                      • qdynamicpropertychangeevent-members.html
                      • qdynamicpropertychangeevent.html
                      • qeasingcurve-members.html
                      • qeasingcurve-obsolete.html
                      • qeasingcurve.html
                      • qelapsedtimer-members.html
                      • qelapsedtimer.html
                      • qenablesharedfromthis-members.html
                      • qenablesharedfromthis.html
                      • qevent-members.html
                      • qevent.html
                      • qeventloop-members.html
                      • qeventloop.html
                      • qeventlooplocker-members.html
                      • qeventlooplocker.html
                      • qeventtransition-members.html
                      • qeventtransition.html
                      • qexception-members.html
                      • qexception.html
                      • qexplicitlyshareddatapointer-members.html
                      • qexplicitlyshareddatapointer.html
                      • qfile-members.html
                      • qfile-obsolete.html
                      • qfile.html
                      • qfiledevice-members.html
                      • qfiledevice.html
                      • qfileinfo-members.html
                      • qfileinfo-obsolete.html
                      • qfileinfo.html
                      • qfileselector-members.html
                      • qfileselector.html
                      • qfilesystemwatcher-members.html
                      • qfilesystemwatcher.html
                      • qfinalstate-members.html
                      • qfinalstate.html
                      • qflag-members.html
                      • qflag.html
                      • qflags-members.html
                      • qflags.html
                      • qfuture-const-iterator-members.html
                      • qfuture-const-iterator.html
                      • qfuture-members.html
                      • qfuture.html
                      • qfutureiterator-members.html
                      • qfutureiterator.html
                      • qfuturesynchronizer-members.html
                      • qfuturesynchronizer.html
                      • qfuturewatcher-members.html
                      • qfuturewatcher.html
                      • qgenericargument-members.html
                      • qgenericargument.html
                      • qgenericreturnargument-members.html
                      • qgenericreturnargument.html
                      • qglobalstatic-members.html
                      • qglobalstatic-obsolete.html
                      • qglobalstatic.html
                      • qhash-const-iterator-members.html
                      • qhash-const-iterator.html
                      • qhash-iterator-members.html
                      • qhash-iterator.html
                      • qhash-key-iterator-members.html
                      • qhash-key-iterator.html
                      • qhash-members.html
                      • qhash.html
                      • qhashiterator-members.html
                      • qhashiterator.html
                      • qhistorystate-members.html
                      • qhistorystate.html
                      • qidentityproxymodel-members.html
                      • qidentityproxymodel.html
                      • qiodevice-members.html
                      • qiodevice.html
                      • qitemselection-members.html
                      • qitemselection.html
                      • qitemselectionmodel-members.html
                      • qitemselectionmodel.html
                      • qitemselectionrange-members.html
                      • qitemselectionrange-obsolete.html
                      • qitemselectionrange.html
                      • qjsonarray-const-iterator-members.html
                      • qjsonarray-const-iterator.html
                      • qjsonarray-iterator-members.html
                      • qjsonarray-iterator.html
                      • qjsonarray-members.html
                      • qjsonarray.html
                      • qjsondocument-members.html
                      • qjsondocument.html
                      • qjsonobject-const-iterator-members.html
                      • qjsonobject-const-iterator.html
                      • qjsonobject-iterator-members.html
                      • qjsonobject-iterator.html
                      • qjsonobject-members.html
                      • qjsonobject.html
                      • qjsonparseerror-members.html
                      • qjsonparseerror.html
                      • qjsonvalue-members.html
                      • qjsonvalue.html
                      • qlatin1char-members.html
                      • qlatin1char.html
                      • qlatin1string-members.html
                      • qlatin1string.html
                      • qlibrary-members.html
                      • qlibrary.html
                      • qlibraryinfo-members.html
                      • qlibraryinfo-obsolete.html
                      • qlibraryinfo.html
                      • qline-members.html
                      • qline.html
                      • qlinef-members.html
                      • qlinef-obsolete.html
                      • qlinef.html
                      • qlinkedlist-const-iterator-members.html
                      • qlinkedlist-const-iterator.html
                      • qlinkedlist-iterator-members.html
                      • qlinkedlist-iterator.html
                      • qlinkedlist-members.html
                      • qlinkedlist.html
                      • qlinkedlistiterator-members.html
                      • qlinkedlistiterator.html
                      • qlist-const-iterator-members.html
                      • qlist-const-iterator.html
                      • qlist-iterator-members.html
                      • qlist-iterator.html
                      • qlist-members.html
                      • qlist-memorylayout.html
                      • qlist.html
                      • qlistiterator-members.html
                      • qlistiterator.html
                      • qlocale-members.html
                      • qlocale-obsolete.html
                      • qlocale.html
                      • qlockfile-members.html
                      • qlockfile.html
                      • qloggingcategory-members.html
                      • qloggingcategory.html
                      • qmap-const-iterator-members.html
                      • qmap-const-iterator.html
                      • qmap-iterator-members.html
                      • qmap-iterator.html
                      • qmap-key-iterator-members.html
                      • qmap-key-iterator.html
                      • qmap-members.html
                      • qmap.html
                      • qmapiterator-members.html
                      • qmapiterator.html
                      • qmargins-members.html
                      • qmargins.html
                      • qmarginsf-members.html
                      • qmarginsf.html
                      • qmessageauthenticationcode-members.html
                      • qmessageauthenticationcode.html
                      • qmessagelogcontext-members.html
                      • qmessagelogcontext.html
                      • qmessagelogger-members.html
                      • qmessagelogger.html
                      • qmetaclassinfo-members.html
                      • qmetaclassinfo.html
                      • qmetaenum-members.html
                      • qmetaenum.html
                      • qmetamethod-members.html
                      • qmetamethod.html
                      • qmetaobject-connection-members.html
                      • qmetaobject-connection.html
                      • qmetaobject-members.html
                      • qmetaobject.html
                      • qmetaproperty-members.html
                      • qmetaproperty-obsolete.html
                      • qmetaproperty.html
                      • qmetatype-members.html
                      • qmetatype-obsolete.html
                      • qmetatype.html
                      • qmimedata-members.html
                      • qmimedata.html
                      • qmimedatabase-members.html
                      • qmimedatabase.html
                      • qmimetype-members.html
                      • qmimetype.html
                      • qmodelindex-members.html
                      • qmodelindex.html
                      • qmultihash-members.html
                      • qmultihash.html
                      • qmultimap-members.html
                      • qmultimap.html
                      • qmutablehashiterator-members.html
                      • qmutablehashiterator.html
                      • qmutablelinkedlistiterator-members.html
                      • qmutablelinkedlistiterator.html
                      • qmutablelistiterator-members.html
                      • qmutablelistiterator.html
                      • qmutablemapiterator-members.html
                      • qmutablemapiterator.html
                      • qmutablesetiterator-members.html
                      • qmutablesetiterator.html
                      • qmutablevectoriterator-members.html
                      • qmutablevectoriterator.html
                      • qmutex-members.html
                      • qmutex.html
                      • qmutexlocker-members.html
                      • qmutexlocker.html
                      • qobject-members.html
                      • qobject-obsolete.html
                      • qobject.html
                      • qobjectcleanuphandler-members.html
                      • qobjectcleanuphandler.html
                      • qpair-members.html
                      • qpair.html
                      • qparallelanimationgroup-members.html
                      • qparallelanimationgroup.html
                      • qpauseanimation-members.html
                      • qpauseanimation.html
                      • qpersistentmodelindex-members.html
                      • qpersistentmodelindex.html
                      • qpluginloader-members.html
                      • qpluginloader.html
                      • qpoint-members.html
                      • qpoint.html
                      • qpointer-members.html
                      • qpointer.html
                      • qpointf-members.html
                      • qpointf.html
                      • qprocess-createprocessarguments-members.html
                      • qprocess-createprocessarguments.html
                      • qprocess-members.html
                      • qprocess-obsolete.html
                      • qprocess.html
                      • qprocessenvironment-members.html
                      • qprocessenvironment.html
                      • qpropertyanimation-members.html
                      • qpropertyanimation.html
                      • qqueue-members.html
                      • qqueue.html
                      • qreadlocker-members.html
                      • qreadlocker.html
                      • qreadwritelock-members.html
                      • qreadwritelock.html
                      • qrect-members.html
                      • qrect-obsolete.html
                      • qrect.html
                      • qrectf-members.html
                      • qrectf-obsolete.html
                      • qrectf.html
                      • qregexp-members.html
                      • qregexp.html
                      • qregularexpression-members.html
                      • qregularexpression.html
                      • qregularexpressionmatch-members.html
                      • qregularexpressionmatch.html
                      • qregularexpressionmatchiterator-members.html
                      • qregularexpressionmatchiterator.html
                      • qresource-members.html
                      • qresource-obsolete.html
                      • qresource.html
                      • qrunnable-members.html
                      • qrunnable.html
                      • qsavefile-members.html
                      • qsavefile.html
                      • qscopedarraypointer-members.html
                      • qscopedarraypointer.html
                      • qscopedpointer-members.html
                      • qscopedpointer.html
                      • qscopedvaluerollback-members.html
                      • qscopedvaluerollback.html
                      • qsemaphore-members.html
                      • qsemaphore.html
                      • qsequentialanimationgroup-members.html
                      • qsequentialanimationgroup.html
                      • qsequentialiterable-const-iterator-members.html
                      • qsequentialiterable-const-iterator.html
                      • qsequentialiterable-members.html
                      • qsequentialiterable.html
                      • qset-const-iterator-members.html
                      • qset-const-iterator.html
                      • qset-iterator-members.html
                      • qset-iterator.html
                      • qset-members.html
                      • qset.html
                      • qsetiterator-members.html
                      • qsetiterator.html
                      • qsettings-members.html
                      • qsettings-obsolete.html
                      • qsettings.html
                      • qshareddata-members.html
                      • qshareddata.html
                      • qshareddatapointer-members.html
                      • qshareddatapointer.html
                      • qsharedmemory-members.html
                      • qsharedmemory.html
                      • qsharedpointer-members.html
                      • qsharedpointer.html
                      • qsignalblocker-members.html
                      • qsignalblocker.html
                      • qsignalmapper-members.html
                      • qsignalmapper.html
                      • qsignaltransition-members.html
                      • qsignaltransition.html
                      • qsize-members.html
                      • qsize.html
                      • qsizef-members.html
                      • qsizef.html
                      • qsocketnotifier-members.html
                      • qsocketnotifier.html
                      • qsortfilterproxymodel-members.html
                      • qsortfilterproxymodel-obsolete.html
                      • qsortfilterproxymodel.html
                      • qstack-members.html
                      • qstack.html
                      • qstandardpaths-members.html
                      • qstandardpaths-obsolete.html
                      • qstandardpaths.html
                      • qstate-members.html
                      • qstate.html
                      • qstatemachine-members.html
                      • qstatemachine-signalevent-members.html
                      • qstatemachine-signalevent.html
                      • qstatemachine-wrappedevent-members.html
                      • qstatemachine-wrappedevent.html
                      • qstatemachine.html
                      • qstaticplugin-members.html
                      • qstaticplugin.html
                      • qstorageinfo-members.html
                      • qstorageinfo.html
                      • qstring-members.html
                      • qstring-null.html
                      • qstring-obsolete.html
                      • qstring.html
                      • qstringlist-members.html
                      • qstringlist.html
                      • qstringlistmodel-members.html
                      • qstringlistmodel.html
                      • qstringmatcher-members.html
                      • qstringmatcher.html
                      • qstringref-members.html
                      • qstringref-obsolete.html
                      • qstringref.html
                      • qsysinfo-members.html
                      • qsysinfo.html
                      • qsystemsemaphore-members.html
                      • qsystemsemaphore.html
                      • qt-obsolete.html
                      • qt.html
                      • qtalgorithms-obsolete.html
                      • qtalgorithms.html
                      • qtcore-index.html
                      • qtcore-ipc-localfortuneclient-client-cpp.html
                      • qtcore-ipc-localfortuneclient-client-h.html
                      • qtcore-ipc-localfortuneclient-example.html
                      • qtcore-ipc-localfortuneclient-localfortuneclient-pro.html
                      • qtcore-ipc-localfortuneclient-main-cpp.html
                      • qtcore-ipc-localfortuneserver-example.html
                      • qtcore-ipc-localfortuneserver-localfortuneserver-pro.html
                      • qtcore-ipc-localfortuneserver-main-cpp.html
                      • qtcore-ipc-localfortuneserver-server-cpp.html
                      • qtcore-ipc-localfortuneserver-server-h.html
                      • qtcore-ipc-sharedmemory-dialog-cpp.html
                      • qtcore-ipc-sharedmemory-dialog-h.html
                      • qtcore-ipc-sharedmemory-dialog-ui.html
                      • qtcore-ipc-sharedmemory-example.html
                      • qtcore-ipc-sharedmemory-main-cpp.html
                      • qtcore-ipc-sharedmemory-sharedmemory-pro.html
                      • qtcore-json-savegame-character-cpp.html
                      • qtcore-json-savegame-character-h.html
                      • qtcore-json-savegame-example.html
                      • qtcore-json-savegame-game-cpp.html
                      • qtcore-json-savegame-game-h.html
                      • qtcore-json-savegame-level-cpp.html
                      • qtcore-json-savegame-level-h.html
                      • qtcore-json-savegame-main-cpp.html
                      • qtcore-json-savegame-savegame-pro.html
                      • qtcore-mimetypes-mimetypebrowser-example.html
                      • qtcore-mimetypes-mimetypebrowser-main-cpp.html
                      • qtcore-mimetypes-mimetypebrowser-mainwindow-cpp.html
                      • qtcore-mimetypes-mimetypebrowser-mainwindow-h.html
                      • qtcore-mimetypes-mimetypebrowser-mimetypebrowser-pro.html
                      • qtcore-mimetypes-mimetypebrowser-mimetypemodel-cpp.html
                      • qtcore-mimetypes-mimetypebrowser-mimetypemodel-h.html
                      • qtcore-module.html
                      • qtcore-threads-mandelbrot-example.html
                      • qtcore-threads-mandelbrot-main-cpp.html
                      • qtcore-threads-mandelbrot-mandelbrot-pro.html
                      • qtcore-threads-mandelbrot-mandelbrotwidget-cpp.html
                      • qtcore-threads-mandelbrot-mandelbrotwidget-h.html
                      • qtcore-threads-mandelbrot-renderthread-cpp.html
                      • qtcore-threads-mandelbrot-renderthread-h.html
                      • qtcore-threads-queuedcustomtype-block-cpp.html
                      • qtcore-threads-queuedcustomtype-block-h.html
                      • qtcore-threads-queuedcustomtype-example.html
                      • qtcore-threads-queuedcustomtype-main-cpp.html
                      • qtcore-threads-queuedcustomtype-queuedcustomtype-pro.html
                      • qtcore-threads-queuedcustomtype-renderthread-cpp.html
                      • qtcore-threads-queuedcustomtype-renderthread-h.html
                      • qtcore-threads-queuedcustomtype-window-cpp.html
                      • qtcore-threads-queuedcustomtype-window-h.html
                      • qtcore-threads-semaphores-example.html
                      • qtcore-threads-semaphores-semaphores-cpp.html
                      • qtcore-threads-semaphores-semaphores-pro.html
                      • qtcore-threads-waitconditions-example.html
                      • qtcore-threads-waitconditions-waitconditions-cpp.html
                      • qtcore-threads-waitconditions-waitconditions-pro.html
                      • qtcore-tools-contiguouscache-contiguouscache-pro.html
                      • qtcore-tools-contiguouscache-example.html
                      • qtcore-tools-contiguouscache-main-cpp.html
                      • qtcore-tools-contiguouscache-randomlistmodel-cpp.html
                      • qtcore-tools-contiguouscache-randomlistmodel-h.html
                      • qtcore-tools-customtype-customtype-pro.html
                      • qtcore-tools-customtype-example.html
                      • qtcore-tools-customtype-main-cpp.html
                      • qtcore-tools-customtype-message-cpp.html
                      • qtcore-tools-customtype-message-h.html
                      • qtcore.index
                      • qtcore.qhp
                      • qtcore.qhp.sha1
                      • qtcore.tags
                      • qtemporarydir-members.html
                      • qtemporarydir.html
                      • qtemporaryfile-members.html
                      • qtemporaryfile-obsolete.html
                      • qtemporaryfile.html
                      • qtendian.html
                      • qtextboundaryfinder-members.html
                      • qtextboundaryfinder.html
                      • qtextcodec-converterstate-members.html
                      • qtextcodec-converterstate.html
                      • qtextcodec-members.html
                      • qtextcodec-obsolete.html
                      • qtextcodec.html
                      • qtextdecoder-members.html
                      • qtextdecoder.html
                      • qtextencoder-members.html
                      • qtextencoder.html
                      • qtextstream-members.html
                      • qtextstream.html
                      • qtglobal-obsolete.html
                      • qtglobal.html
                      • qthread-members.html
                      • qthread.html
                      • qthreadpool-members.html
                      • qthreadpool.html
                      • qthreadstorage-members.html
                      • qthreadstorage.html
                      • qtime-members.html
                      • qtime.html
                      • qtimeline-members.html
                      • qtimeline.html
                      • qtimer-members.html
                      • qtimer.html
                      • qtimerevent-members.html
                      • qtimerevent.html
                      • qtimezone-members.html
                      • qtimezone-offsetdata-members.html
                      • qtimezone-offsetdata.html
                      • qtimezone.html
                      • qtmath.html
                      • qtplugin.html
                      • qtranslator-members.html
                      • qtranslator.html
                      • qunhandledexception-members.html
                      • qunhandledexception.html
                      • qurl-members.html
                      • qurl-obsolete.html
                      • qurl.html
                      • qurlquery-members.html
                      • qurlquery.html
                      • quuid-members.html
                      • quuid.html
                      • qvariant-members.html
                      • qvariant-obsolete.html
                      • qvariant.html
                      • qvariantanimation-members.html
                      • qvariantanimation.html
                      • qvarlengtharray-members.html
                      • qvarlengtharray.html
                      • qvector-members.html
                      • qvector.html
                      • qvectoriterator-members.html
                      • qvectoriterator.html
                      • qversionnumber-members.html
                      • qversionnumber.html
                      • qwaitcondition-members.html
                      • qwaitcondition.html
                      • qweakpointer-members.html
                      • qweakpointer-obsolete.html
                      • qweakpointer.html
                      • qwineventnotifier-members.html
                      • qwineventnotifier.html
                      • qwritelocker-members.html
                      • qwritelocker.html
                      • qxmlstreamattribute-members.html
                      • qxmlstreamattribute.html
                      • qxmlstreamattributes-members.html
                      • qxmlstreamattributes.html
                      • qxmlstreamentitydeclaration-members.html
                      • qxmlstreamentitydeclaration.html
                      • qxmlstreamentityresolver-members.html
                      • qxmlstreamentityresolver.html
                      • qxmlstreamnamespacedeclaration-members.html
                      • qxmlstreamnamespacedeclaration.html
                      • qxmlstreamnotationdeclaration-members.html
                      • qxmlstreamnotationdeclaration.html
                      • qxmlstreamreader-members.html
                      • qxmlstreamreader.html
                      • qxmlstreamwriter-members.html
                      • qxmlstreamwriter.html
                      • resources.html
                      • shared.html
                      • signalsandslots.html
                      • statemachine-api.html
                      • statemachine.html
                      • style
                        • offline-simple.css
                        • offline.css
                      • timers.html
                    • qtdatavis3d.qch
                    • qtdatavisualization
                      • datavisualization-examples.html
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • audiolevels-example.png
                        • bars-example.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • custominput-example.png
                        • customitems-example.png
                        • customproxy-example.png
                        • draggableaxes-example.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • itemmodel-example-2.png
                        • itemmodel-example.png
                        • logo.png
                        • q3dbars-minimal.png
                        • q3dscatter-minimal.png
                        • q3dsurface-minimal.png
                        • qmlaxisdrag-example.png
                        • qmlaxisformatter-example.png
                        • qmlbars-example.png
                        • qmlcustominput-example.png
                        • qmllegend-example.png
                        • qmlmultigraph-example.png
                        • qmloscilloscope-example.png
                        • qmlscatter-example.png
                        • qmlspectrogram-example.png
                        • qmlsurface-example.png
                        • qmlsurfacelayers-example.png
                        • rotations-example.png
                        • scatter-example.png
                        • surface-example.png
                        • texturesurface-example.png
                        • volumetric-example.png
                      • q3dbars-members.html
                      • q3dbars.html
                      • q3dcamera-members.html
                      • q3dcamera.html
                      • q3dinputhandler-members.html
                      • q3dinputhandler.html
                      • q3dlight-members.html
                      • q3dlight.html
                      • q3dobject-members.html
                      • q3dobject.html
                      • q3dscatter-members.html
                      • q3dscatter.html
                      • q3dscene-members.html
                      • q3dscene.html
                      • q3dsurface-members.html
                      • q3dsurface.html
                      • q3dtheme-members.html
                      • q3dtheme.html
                      • qabstract3daxis-members.html
                      • qabstract3daxis.html
                      • qabstract3dgraph-members.html
                      • qabstract3dgraph.html
                      • qabstract3dinputhandler-members.html
                      • qabstract3dinputhandler.html
                      • qabstract3dseries-members.html
                      • qabstract3dseries.html
                      • qabstractdataproxy-members.html
                      • qabstractdataproxy.html
                      • qbar3dseries-members.html
                      • qbar3dseries.html
                      • qbardataitem-members.html
                      • qbardataitem.html
                      • qbardataproxy-members.html
                      • qbardataproxy.html
                      • qcategory3daxis-members.html
                      • qcategory3daxis.html
                      • qcustom3ditem-members.html
                      • qcustom3ditem.html
                      • qcustom3dlabel-members.html
                      • qcustom3dlabel.html
                      • qcustom3dvolume-members.html
                      • qcustom3dvolume.html
                      • qheightmapsurfacedataproxy-members.html
                      • qheightmapsurfacedataproxy.html
                      • qitemmodelbardataproxy-members.html
                      • qitemmodelbardataproxy.html
                      • qitemmodelscatterdataproxy-members.html
                      • qitemmodelscatterdataproxy.html
                      • qitemmodelsurfacedataproxy-members.html
                      • qitemmodelsurfacedataproxy.html
                      • qlogvalue3daxisformatter-members.html
                      • qlogvalue3daxisformatter.html
                      • qml-qtdatavisualization-abstract3dseries-members.html
                      • qml-qtdatavisualization-abstract3dseries.html
                      • qml-qtdatavisualization-abstractaxis3d-members.html
                      • qml-qtdatavisualization-abstractaxis3d.html
                      • qml-qtdatavisualization-abstractdataproxy-members.html
                      • qml-qtdatavisualization-abstractdataproxy.html
                      • qml-qtdatavisualization-abstractgraph3d-members.html
                      • qml-qtdatavisualization-abstractgraph3d.html
                      • qml-qtdatavisualization-abstractinputhandler3d-members.html
                      • qml-qtdatavisualization-abstractinputhandler3d.html
                      • qml-qtdatavisualization-bar3dseries-members.html
                      • qml-qtdatavisualization-bar3dseries.html
                      • qml-qtdatavisualization-bardataproxy-members.html
                      • qml-qtdatavisualization-bardataproxy.html
                      • qml-qtdatavisualization-bars3d-members.html
                      • qml-qtdatavisualization-bars3d.html
                      • qml-qtdatavisualization-camera3d-members.html
                      • qml-qtdatavisualization-camera3d.html
                      • qml-qtdatavisualization-categoryaxis3d-members.html
                      • qml-qtdatavisualization-categoryaxis3d.html
                      • qml-qtdatavisualization-colorgradient-members.html
                      • qml-qtdatavisualization-colorgradient.html
                      • qml-qtdatavisualization-colorgradientstop-members.html
                      • qml-qtdatavisualization-colorgradientstop.html
                      • qml-qtdatavisualization-custom3ditem-members.html
                      • qml-qtdatavisualization-custom3ditem.html
                      • qml-qtdatavisualization-custom3dlabel-members.html
                      • qml-qtdatavisualization-custom3dlabel.html
                      • qml-qtdatavisualization-custom3dvolume-members.html
                      • qml-qtdatavisualization-custom3dvolume.html
                      • qml-qtdatavisualization-heightmapsurfacedataproxy-members.html
                      • qml-qtdatavisualization-heightmapsurfacedataproxy.html
                      • qml-qtdatavisualization-inputhandler3d-members.html
                      • qml-qtdatavisualization-inputhandler3d.html
                      • qml-qtdatavisualization-itemmodelbardataproxy-members.html
                      • qml-qtdatavisualization-itemmodelbardataproxy.html
                      • qml-qtdatavisualization-itemmodelscatterdataproxy-members.html
                      • qml-qtdatavisualization-itemmodelscatterdataproxy.html
                      • qml-qtdatavisualization-itemmodelsurfacedataproxy-members.html
                      • qml-qtdatavisualization-itemmodelsurfacedataproxy.html
                      • qml-qtdatavisualization-light3d-members.html
                      • qml-qtdatavisualization-light3d.html
                      • qml-qtdatavisualization-logvalueaxis3dformatter-members.html
                      • qml-qtdatavisualization-logvalueaxis3dformatter.html
                      • qml-qtdatavisualization-scatter3d-members.html
                      • qml-qtdatavisualization-scatter3d.html
                      • qml-qtdatavisualization-scatter3dseries-members.html
                      • qml-qtdatavisualization-scatter3dseries.html
                      • qml-qtdatavisualization-scatterdataproxy-members.html
                      • qml-qtdatavisualization-scatterdataproxy.html
                      • qml-qtdatavisualization-scene3d-members.html
                      • qml-qtdatavisualization-scene3d.html
                      • qml-qtdatavisualization-surface3d-members.html
                      • qml-qtdatavisualization-surface3d.html
                      • qml-qtdatavisualization-surface3dseries-members.html
                      • qml-qtdatavisualization-surface3dseries.html
                      • qml-qtdatavisualization-surfacedataproxy-members.html
                      • qml-qtdatavisualization-surfacedataproxy.html
                      • qml-qtdatavisualization-theme3d-members.html
                      • qml-qtdatavisualization-theme3d.html
                      • qml-qtdatavisualization-themecolor-members.html
                      • qml-qtdatavisualization-themecolor.html
                      • qml-qtdatavisualization-touchinputhandler3d-members.html
                      • qml-qtdatavisualization-touchinputhandler3d.html
                      • qml-qtdatavisualization-valueaxis3d-members.html
                      • qml-qtdatavisualization-valueaxis3d.html
                      • qml-qtdatavisualization-valueaxis3dformatter-members.html
                      • qml-qtdatavisualization-valueaxis3dformatter.html
                      • qscatter3dseries-members.html
                      • qscatter3dseries.html
                      • qscatterdataitem-members.html
                      • qscatterdataitem.html
                      • qscatterdataproxy-members.html
                      • qscatterdataproxy.html
                      • qsurface3dseries-members.html
                      • qsurface3dseries.html
                      • qsurfacedataitem-members.html
                      • qsurfacedataitem.html
                      • qsurfacedataproxy-members.html
                      • qsurfacedataproxy.html
                      • qtdatavis3d.qhp
                      • qtdatavis3d.qhp.sha1
                      • qtdatavisualization-audiolevels-audiolevels-cpp.html
                      • qtdatavisualization-audiolevels-audiolevels-h.html
                      • qtdatavisualization-audiolevels-audiolevels-pro.html
                      • qtdatavisualization-audiolevels-audiolevelsiodevice-cpp.html
                      • qtdatavisualization-audiolevels-audiolevelsiodevice-h.html
                      • qtdatavisualization-audiolevels-example.html
                      • qtdatavisualization-audiolevels-main-cpp.html
                      • qtdatavisualization-bars-bars-pro.html
                      • qtdatavisualization-bars-example.html
                      • qtdatavisualization-bars-graphmodifier-cpp.html
                      • qtdatavisualization-bars-graphmodifier-h.html
                      • qtdatavisualization-bars-main-cpp.html
                      • qtdatavisualization-custominput-custominput-pro.html
                      • qtdatavisualization-custominput-custominput-qrc.html
                      • qtdatavisualization-custominput-custominputhandler-cpp.html
                      • qtdatavisualization-custominput-custominputhandler-h.html
                      • qtdatavisualization-custominput-example.html
                      • qtdatavisualization-custominput-main-cpp.html
                      • qtdatavisualization-custominput-scatterdatamodifier-cpp.html
                      • qtdatavisualization-custominput-scatterdatamodifier-h.html
                      • qtdatavisualization-customitems-customitemgraph-cpp.html
                      • qtdatavisualization-customitems-customitemgraph-h.html
                      • qtdatavisualization-customitems-customitems-pro.html
                      • qtdatavisualization-customitems-customitems-qrc.html
                      • qtdatavisualization-customitems-example.html
                      • qtdatavisualization-customitems-main-cpp.html
                      • qtdatavisualization-customproxy-customproxy-pro.html
                      • qtdatavisualization-customproxy-customproxy-qrc.html
                      • qtdatavisualization-customproxy-example.html
                      • qtdatavisualization-customproxy-main-cpp.html
                      • qtdatavisualization-customproxy-rainfallgraph-cpp.html
                      • qtdatavisualization-customproxy-rainfallgraph-h.html
                      • qtdatavisualization-customproxy-variantbardatamapping-cpp.html
                      • qtdatavisualization-customproxy-variantbardatamapping-h.html
                      • qtdatavisualization-customproxy-variantbardataproxy-cpp.html
                      • qtdatavisualization-customproxy-variantbardataproxy-h.html
                      • qtdatavisualization-customproxy-variantdataset-cpp.html
                      • qtdatavisualization-customproxy-variantdataset-h.html
                      • qtdatavisualization-data-handling.html
                      • qtdatavisualization-draggableaxes-axesinputhandler-cpp.html
                      • qtdatavisualization-draggableaxes-axesinputhandler-h.html
                      • qtdatavisualization-draggableaxes-data-cpp.html
                      • qtdatavisualization-draggableaxes-data-h.html
                      • qtdatavisualization-draggableaxes-draggableaxes-pro.html
                      • qtdatavisualization-draggableaxes-example.html
                      • qtdatavisualization-draggableaxes-main-cpp.html
                      • qtdatavisualization-getting-started.html
                      • qtdatavisualization-index.html
                      • qtdatavisualization-interacting-with-data.html
                      • qtdatavisualization-itemmodel-example.html
                      • qtdatavisualization-itemmodel-itemmodel-pro.html
                      • qtdatavisualization-itemmodel-main-cpp.html
                      • qtdatavisualization-known-issues.html
                      • qtdatavisualization-module.html
                      • qtdatavisualization-qmlaxisdrag-example.html
                      • qtdatavisualization-qmlaxisdrag-main-cpp.html
                      • qtdatavisualization-qmlaxisdrag-qml-qmlaxisdrag-main-qml.html
                      • qtdatavisualization-qmlaxisdrag-qml-qmlaxisdrag-newbutton-qml.html
                      • qtdatavisualization-qmlaxisdrag-qmlaxisdrag-pro.html
                      • qtdatavisualization-qmlaxisdrag-qmlaxisdrag-qrc.html
                      • qtdatavisualization-qmlaxisformatter-customformatter-cpp.html
                      • qtdatavisualization-qmlaxisformatter-customformatter-h.html
                      • qtdatavisualization-qmlaxisformatter-example.html
                      • qtdatavisualization-qmlaxisformatter-main-cpp.html
                      • qtdatavisualization-qmlaxisformatter-qml-qmlaxisformatter-data-qml.html
                      • qtdatavisualization-qmlaxisformatter-qml-qmlaxisformatter-main-qml.html
                      • qtdatavisualization-qmlaxisformatter-qml-qmlaxisformatter-newbutton-qml.html
                      • qtdatavisualization-qmlaxisformatter-qmlaxisformatter-pro.html
                      • qtdatavisualization-qmlaxisformatter-qmlaxisformatter-qrc.html
                      • qtdatavisualization-qmlbars-example.html
                      • qtdatavisualization-qmlbars-main-cpp.html
                      • qtdatavisualization-qmlbars-qml-qmlbars-axes-qml.html
                      • qtdatavisualization-qmlbars-qml-qmlbars-data-qml.html
                      • qtdatavisualization-qmlbars-qml-qmlbars-main-qml.html
                      • qtdatavisualization-qmlbars-qmlbars-pro.html
                      • qtdatavisualization-qmlbars-qmlbars-qrc.html
                      • qtdatavisualization-qmlcustominput-example.html
                      • qtdatavisualization-qmlcustominput-main-cpp.html
                      • qtdatavisualization-qmlcustominput-qml-qmlcustominput-data-qml.html
                      • qtdatavisualization-qmlcustominput-qml-qmlcustominput-main-qml.html
                      • qtdatavisualization-qmlcustominput-qml-qmlcustominput-newbutton-qml.html
                      • qtdatavisualization-qmlcustominput-qmlcustominput-pro.html
                      • qtdatavisualization-qmlcustominput-qmlcustominput-qrc.html
                      • qtdatavisualization-qmllegend-example.html
                      • qtdatavisualization-qmllegend-main-cpp.html
                      • qtdatavisualization-qmllegend-qml-qmllegend-data-qml.html
                      • qtdatavisualization-qmllegend-qml-qmllegend-legenditem-qml.html
                      • qtdatavisualization-qmllegend-qml-qmllegend-main-qml.html
                      • qtdatavisualization-qmllegend-qml-qmllegend-newbutton-qml.html
                      • qtdatavisualization-qmllegend-qmllegend-pro.html
                      • qtdatavisualization-qmllegend-qmllegend-qrc.html
                      • qtdatavisualization-qmlmodule.html
                      • qtdatavisualization-qmlmultigraph-example.html
                      • qtdatavisualization-qmlmultigraph-main-cpp.html
                      • qtdatavisualization-qmlmultigraph-qml-qmlmultigraph-data-qml.html
                      • qtdatavisualization-qmlmultigraph-qml-qmlmultigraph-main-qml.html
                      • qtdatavisualization-qmlmultigraph-qml-qmlmultigraph-newbutton-qml.html
                      • qtdatavisualization-qmlmultigraph-qmlmultigraph-pro.html
                      • qtdatavisualization-qmlmultigraph-qmlmultigraph-qrc.html
                      • qtdatavisualization-qmloscilloscope-datasource-cpp.html
                      • qtdatavisualization-qmloscilloscope-datasource-h.html
                      • qtdatavisualization-qmloscilloscope-example.html
                      • qtdatavisualization-qmloscilloscope-main-cpp.html
                      • qtdatavisualization-qmloscilloscope-qml-qmloscilloscope-main-qml.html
                      • qtdatavisualization-qmloscilloscope-qml-qmloscilloscope-newbutton-qml.html
                      • qtdatavisualization-qmloscilloscope-qmloscilloscope-pro.html
                      • qtdatavisualization-qmloscilloscope-qmloscilloscope-qrc.html
                      • qtdatavisualization-qmlscatter-example.html
                      • qtdatavisualization-qmlscatter-main-cpp.html
                      • qtdatavisualization-qmlscatter-qml-qmlscatter-data-qml.html
                      • qtdatavisualization-qmlscatter-qml-qmlscatter-main-qml.html
                      • qtdatavisualization-qmlscatter-qml-qmlscatter-newbutton-qml.html
                      • qtdatavisualization-qmlscatter-qmlscatter-pro.html
                      • qtdatavisualization-qmlscatter-qmlscatter-qrc.html
                      • qtdatavisualization-qmlspectrogram-example.html
                      • qtdatavisualization-qmlspectrogram-main-cpp.html
                      • qtdatavisualization-qmlspectrogram-qml-qmlspectrogram-data-qml.html
                      • qtdatavisualization-qmlspectrogram-qml-qmlspectrogram-main-qml.html
                      • qtdatavisualization-qmlspectrogram-qml-qmlspectrogram-newbutton-qml.html
                      • qtdatavisualization-qmlspectrogram-qmlspectrogram-pro.html
                      • qtdatavisualization-qmlspectrogram-qmlspectrogram-qrc.html
                      • qtdatavisualization-qmlsurface-example.html
                      • qtdatavisualization-qmlsurface-main-cpp.html
                      • qtdatavisualization-qmlsurface-qml-qmlsurface-data-qml.html
                      • qtdatavisualization-qmlsurface-qml-qmlsurface-main-qml.html
                      • qtdatavisualization-qmlsurface-qml-qmlsurface-newbutton-qml.html
                      • qtdatavisualization-qmlsurface-qmlsurface-pro.html
                      • qtdatavisualization-qmlsurface-qmlsurface-qrc.html
                      • qtdatavisualization-qmlsurfacelayers-example.html
                      • qtdatavisualization-qmlsurfacelayers-main-cpp.html
                      • qtdatavisualization-qmlsurfacelayers-qml-qmlsurfacelayers-main-qml.html
                      • qtdatavisualization-qmlsurfacelayers-qml-qmlsurfacelayers-newbutton-qml.html
                      • qtdatavisualization-qmlsurfacelayers-qmlsurfacelayers-pro.html
                      • qtdatavisualization-qmlsurfacelayers-qmlsurfacelayers-qrc.html
                      • qtdatavisualization-rotations-example.html
                      • qtdatavisualization-rotations-main-cpp.html
                      • qtdatavisualization-rotations-rotations-pro.html
                      • qtdatavisualization-rotations-rotations-qrc.html
                      • qtdatavisualization-rotations-scatterdatamodifier-cpp.html
                      • qtdatavisualization-rotations-scatterdatamodifier-h.html
                      • qtdatavisualization-scatter-example.html
                      • qtdatavisualization-scatter-main-cpp.html
                      • qtdatavisualization-scatter-scatter-pro.html
                      • qtdatavisualization-scatter-scatterdatamodifier-cpp.html
                      • qtdatavisualization-scatter-scatterdatamodifier-h.html
                      • qtdatavisualization-surface-example.html
                      • qtdatavisualization-surface-main-cpp.html
                      • qtdatavisualization-surface-surface-pro.html
                      • qtdatavisualization-surface-surface-qrc.html
                      • qtdatavisualization-surface-surfacegraph-cpp.html
                      • qtdatavisualization-surface-surfacegraph-h.html
                      • qtdatavisualization-texturesurface-custominputhandler-cpp.html
                      • qtdatavisualization-texturesurface-custominputhandler-h.html
                      • qtdatavisualization-texturesurface-example.html
                      • qtdatavisualization-texturesurface-highlightseries-cpp.html
                      • qtdatavisualization-texturesurface-highlightseries-h.html
                      • qtdatavisualization-texturesurface-main-cpp.html
                      • qtdatavisualization-texturesurface-surfacegraph-cpp.html
                      • qtdatavisualization-texturesurface-surfacegraph-h.html
                      • qtdatavisualization-texturesurface-texturedsurface-qrc.html
                      • qtdatavisualization-texturesurface-texturesurface-pro.html
                      • qtdatavisualization-texturesurface-topographicseries-cpp.html
                      • qtdatavisualization-texturesurface-topographicseries-h.html
                      • qtdatavisualization-volumetric-example.html
                      • qtdatavisualization-volumetric-main-cpp.html
                      • qtdatavisualization-volumetric-volumetric-cpp.html
                      • qtdatavisualization-volumetric-volumetric-h.html
                      • qtdatavisualization-volumetric-volumetric-pro.html
                      • qtdatavisualization-volumetric-volumetric-qrc.html
                      • qtdatavisualization.html
                      • qtdatavisualization.index
                      • qtouch3dinputhandler-members.html
                      • qtouch3dinputhandler.html
                      • qvalue3daxis-members.html
                      • qvalue3daxis.html
                      • qvalue3daxisformatter-members.html
                      • qvalue3daxisformatter.html
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtdbus.qch
                    • qtdbus
                      • examples-dbus.html
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • dbus-chat-example.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • qurl-ftppath.png
                        • remotecontrolledcar-car-example.png
                      • qdbus.html
                      • qdbusabstractadaptor-members.html
                      • qdbusabstractadaptor.html
                      • qdbusabstractinterface-members.html
                      • qdbusabstractinterface.html
                      • qdbusadaptorexample.html
                      • qdbusargument-members.html
                      • qdbusargument.html
                      • qdbusconnection-members.html
                      • qdbusconnection-obsolete.html
                      • qdbusconnection.html
                      • qdbusconnectioninterface-members.html
                      • qdbusconnectioninterface-obsolete.html
                      • qdbusconnectioninterface.html
                      • qdbuscontext-members.html
                      • qdbuscontext.html
                      • qdbusdeclaringsignals.html
                      • qdbusdeclaringslots.html
                      • qdbuserror-members.html
                      • qdbuserror.html
                      • qdbusinterface-members.html
                      • qdbusinterface.html
                      • qdbusmessage-members.html
                      • qdbusmessage.html
                      • qdbusobjectpath-members.html
                      • qdbusobjectpath.html
                      • qdbuspendingcall-members.html
                      • qdbuspendingcall.html
                      • qdbuspendingcallwatcher-members.html
                      • qdbuspendingcallwatcher.html
                      • qdbuspendingreply-members.html
                      • qdbuspendingreply.html
                      • qdbusreply-members.html
                      • qdbusreply.html
                      • qdbusserver-members.html
                      • qdbusserver.html
                      • qdbusservicewatcher-members.html
                      • qdbusservicewatcher.html
                      • qdbussignature-members.html
                      • qdbussignature.html
                      • qdbustypesystem.html
                      • qdbusunixfiledescriptor-members.html
                      • qdbusunixfiledescriptor.html
                      • qdbusvariant-members.html
                      • qdbusvariant.html
                      • qdbusviewer.html
                      • qdbusvirtualobject-members.html
                      • qdbusvirtualobject.html
                      • qdbusxml2cpp.html
                      • qtdbus-chat-chat-cpp.html
                      • qtdbus-chat-chat-h.html
                      • qtdbus-chat-chat-pro.html
                      • qtdbus-chat-chatmainwindow-ui.html
                      • qtdbus-chat-chatsetnickname-ui.html
                      • qtdbus-chat-example.html
                      • qtdbus-chat-org-example-chat-xml.html
                      • qtdbus-complexpingpong-complexping-cpp.html
                      • qtdbus-complexpingpong-complexping-h.html
                      • qtdbus-complexpingpong-complexping-pro.html
                      • qtdbus-complexpingpong-complexpingpong-pro.html
                      • qtdbus-complexpingpong-complexpong-cpp.html
                      • qtdbus-complexpingpong-complexpong-h.html
                      • qtdbus-complexpingpong-complexpong-pro.html
                      • qtdbus-complexpingpong-example.html
                      • qtdbus-complexpingpong-ping-common-h.html
                      • qtdbus-index.html
                      • qtdbus-listnames-example.html
                      • qtdbus-listnames-listnames-cpp.html
                      • qtdbus-listnames-listnames-pro.html
                      • qtdbus-module.html
                      • qtdbus-pingpong-example.html
                      • qtdbus-pingpong-ping-common-h.html
                      • qtdbus-pingpong-ping-cpp.html
                      • qtdbus-pingpong-ping-pro.html
                      • qtdbus-pingpong-pingpong-pro.html
                      • qtdbus-pingpong-pong-cpp.html
                      • qtdbus-pingpong-pong-h.html
                      • qtdbus-pingpong-pong-pro.html
                      • qtdbus-remotecontrolledcar-car-car-cpp.html
                      • qtdbus-remotecontrolledcar-car-car-h.html
                      • qtdbus-remotecontrolledcar-car-car-pro.html
                      • qtdbus-remotecontrolledcar-car-car-xml.html
                      • qtdbus-remotecontrolledcar-car-main-cpp.html
                      • qtdbus-remotecontrolledcar-controller-car-xml.html
                      • qtdbus-remotecontrolledcar-controller-controller-cpp.html
                      • qtdbus-remotecontrolledcar-controller-controller-h.html
                      • qtdbus-remotecontrolledcar-controller-controller-pro.html
                      • qtdbus-remotecontrolledcar-controller-controller-ui.html
                      • qtdbus-remotecontrolledcar-example.html
                      • qtdbus-remotecontrolledcar-remotecontrolledcar-pro.html
                      • qtdbus.index
                      • qtdbus.qhp
                      • qtdbus.qhp.sha1
                      • style
                        • offline-simple.css
                        • offline.css
                      • usingadaptors.html
                    • qtdesigner.qch
                    • qtdesigner
                      • designer-buddy-mode.html
                      • designer-connection-mode.html
                      • designer-creating-custom-widgets-extensions.html
                      • designer-creating-custom-widgets.html
                      • designer-creating-mainwindows.html
                      • designer-customizing-forms.html
                      • designer-editing-mode.html
                      • designer-layouts.html
                      • designer-license-information.html
                      • designer-preview.html
                      • designer-quick-start.html
                      • designer-resources.html
                      • designer-stylesheet.html
                      • designer-tab-order.html
                      • designer-to-know.html
                      • designer-ui-file-format.html
                      • designer-using-a-ui-file.html
                      • designer-using-containers.html
                      • designer-using-custom-widgets.html
                      • designer-widget-mode.html
                      • examples-designer.html
                      • examples-manifest.xml
                      • images
                        • addressbook-tutorial-part3-labeled-layout.png
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • calculatorbuilder-example.png
                        • calculatorform-example.png
                        • containerextension-example.png
                        • customwidgetplugin-example.png
                        • designer-action-editor.png
                        • designer-add-files-button.png
                        • designer-add-resource-entry-button.png
                        • designer-adding-dockwidget.png
                        • designer-adding-menu-action.png
                        • designer-adding-toolbar-action.png
                        • designer-buddy-making.png
                        • designer-buddy-mode.png
                        • designer-buddy-tool.png
                        • designer-choosing-form.png
                        • designer-code-viewer.png
                        • designer-connection-dialog.png
                        • designer-connection-editing.png
                        • designer-connection-editor.png
                        • designer-connection-highlight.png
                        • designer-connection-making.png
                        • designer-connection-mode.png
                        • designer-connection-to-form.png
                        • designer-connection-tool.png
                        • designer-containers-dockwidget.png
                        • designer-containers-frame.png
                        • designer-containers-groupbox.png
                        • designer-containers-stackedwidget.png
                        • designer-containers-tabwidget.png
                        • designer-containers-toolbox.png
                        • designer-creating-menu-entry1.png
                        • designer-creating-menu-entry2.png
                        • designer-creating-menu-entry3.png
                        • designer-creating-menu-entry4.png
                        • designer-creating-menu1.png
                        • designer-creating-menu2.png
                        • designer-creating-menu3.png
                        • designer-creating-menu4.png
                        • designer-creating-toolbar.png
                        • designer-dialog-preview.png
                        • designer-dragging-onto-form.png
                        • designer-edit-resource.png
                        • designer-edit-resources-button.png
                        • designer-editing-mode.png
                        • designer-english-dialog.png
                        • designer-file-menu.png
                        • designer-form-layout-cleanlooks.png
                        • designer-form-layout-macintosh.png
                        • designer-form-layout-windowsXP.png
                        • designer-form-layout.png
                        • designer-form-layoutfunction.png
                        • designer-form-settings.png
                        • designer-form-viewcode.png
                        • designer-french-dialog.png
                        • designer-layout-inserting.png
                        • designer-main-window.png
                        • designer-manual-containerextension.png
                        • designer-manual-membersheetextension.png
                        • designer-manual-propertysheetextension.png
                        • designer-manual-taskmenuextension.png
                        • designer-multiple-screenshot.png
                        • designer-object-inspector.png
                        • designer-preview-deviceskin-selection.png
                        • designer-preview-style-selection.png
                        • designer-preview-style.png
                        • designer-preview-stylesheet.png
                        • designer-promoting-widgets.png
                        • designer-property-editor-add-dynamic.png
                        • designer-property-editor-configure.png
                        • designer-property-editor-remove-dynamic.png
                        • designer-property-editor-toolbar.png
                        • designer-property-editor.png
                        • designer-reload-resources-button.png
                        • designer-remove-resource-entry-button.png
                        • designer-removing-toolbar-action.png
                        • designer-resource-browser.png
                        • designer-resource-selector.png
                        • designer-resources-editing.png
                        • designer-resources-using.png
                        • designer-screenshot.png
                        • designer-selecting-widget.png
                        • designer-set-layout.png
                        • designer-set-layout2.png
                        • designer-splitter-layout.png
                        • designer-stylesheet-options.png
                        • designer-stylesheet-usage.png
                        • designer-tab-order-mode.png
                        • designer-tab-order-tool.png
                        • designer-widget-box.png
                        • designer-widget-morph.png
                        • designer-widget-tool.png
                        • directapproach-calculatorform.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • qtdesignerextensions.png
                        • qtdesignerscreenshot.png
                        • rgbController-arrangement.png
                        • rgbController-configure-connection1.png
                        • rgbController-configure-connection2.png
                        • rgbController-final-layout.png
                        • rgbController-form-gridLayout.png
                        • rgbController-no-toplevel-layout.png
                        • rgbController-property-editing.png
                        • rgbController-screenshot.png
                        • rgbController-selectForLayout.png
                        • rgbController-signalsAndSlots.png
                        • taskmenuextension-dialog.png
                        • taskmenuextension-example-faded.png
                        • taskmenuextension-menu.png
                        • worldtimeclock-connection.png
                        • worldtimeclock-signalandslot.png
                        • worldtimeclockbuilder-example.png
                        • worldtimeclockplugin-example.png
                      • qabstractextensionfactory-members.html
                      • qabstractextensionfactory.html
                      • qabstractextensionmanager-members.html
                      • qabstractextensionmanager.html
                      • qabstractformbuilder-members.html
                      • qabstractformbuilder.html
                      • qdesigneractioneditorinterface-members.html
                      • qdesigneractioneditorinterface.html
                      • qdesignercontainerextension-members.html
                      • qdesignercontainerextension.html
                      • qdesignercustomwidgetcollectioninterface-members.html
                      • qdesignercustomwidgetcollectioninterface.html
                      • qdesignercustomwidgetinterface-members.html
                      • qdesignercustomwidgetinterface.html
                      • qdesignerdynamicpropertysheetextension-members.html
                      • qdesignerdynamicpropertysheetextension.html
                      • qdesignerformeditorinterface-members.html
                      • qdesignerformeditorinterface.html
                      • qdesignerformwindowcursorinterface-members.html
                      • qdesignerformwindowcursorinterface.html
                      • qdesignerformwindowinterface-members.html
                      • qdesignerformwindowinterface.html
                      • qdesignerformwindowmanagerinterface-members.html
                      • qdesignerformwindowmanagerinterface-obsolete.html
                      • qdesignerformwindowmanagerinterface.html
                      • qdesignermembersheetextension-members.html
                      • qdesignermembersheetextension.html
                      • qdesignerobjectinspectorinterface-members.html
                      • qdesignerobjectinspectorinterface.html
                      • qdesignerpropertyeditorinterface-members.html
                      • qdesignerpropertyeditorinterface.html
                      • qdesignerpropertysheetextension-members.html
                      • qdesignerpropertysheetextension.html
                      • qdesignertaskmenuextension-members.html
                      • qdesignertaskmenuextension.html
                      • qdesignerwidgetboxinterface-members.html
                      • qdesignerwidgetboxinterface.html
                      • qextensionfactory-members.html
                      • qextensionfactory.html
                      • qextensionmanager-members.html
                      • qextensionmanager.html
                      • qformbuilder-members.html
                      • qformbuilder.html
                      • qtdesigner-calculatorbuilder-calculatorbuilder-pro.html
                      • qtdesigner-calculatorbuilder-calculatorbuilder-qrc.html
                      • qtdesigner-calculatorbuilder-calculatorform-cpp.html
                      • qtdesigner-calculatorbuilder-calculatorform-h.html
                      • qtdesigner-calculatorbuilder-calculatorform-ui.html
                      • qtdesigner-calculatorbuilder-example.html
                      • qtdesigner-calculatorbuilder-main-cpp.html
                      • qtdesigner-calculatorform-calculatorform-cpp.html
                      • qtdesigner-calculatorform-calculatorform-h.html
                      • qtdesigner-calculatorform-calculatorform-pro.html
                      • qtdesigner-calculatorform-calculatorform-ui.html
                      • qtdesigner-calculatorform-example.html
                      • qtdesigner-calculatorform-main-cpp.html
                      • qtdesigner-components.html
                      • qtdesigner-containerextension-containerextension-pro.html
                      • qtdesigner-containerextension-example.html
                      • qtdesigner-containerextension-multipagewidget-cpp.html
                      • qtdesigner-containerextension-multipagewidget-h.html
                      • qtdesigner-containerextension-multipagewidgetcontainerextension-cpp.html
                      • qtdesigner-containerextension-multipagewidgetcontainerextension-h.html
                      • qtdesigner-containerextension-multipagewidgetextensionfactory-cpp.html
                      • qtdesigner-containerextension-multipagewidgetextensionfactory-h.html
                      • qtdesigner-containerextension-multipagewidgetplugin-cpp.html
                      • qtdesigner-containerextension-multipagewidgetplugin-h.html
                      • qtdesigner-customwidgetplugin-analogclock-cpp.html
                      • qtdesigner-customwidgetplugin-analogclock-h.html
                      • qtdesigner-customwidgetplugin-customwidgetplugin-cpp.html
                      • qtdesigner-customwidgetplugin-customwidgetplugin-h.html
                      • qtdesigner-customwidgetplugin-customwidgetplugin-pro.html
                      • qtdesigner-customwidgetplugin-example.html
                      • qtdesigner-index.html
                      • qtdesigner-manual.html
                      • qtdesigner-module.html
                      • qtdesigner-taskmenuextension-example.html
                      • qtdesigner-taskmenuextension-taskmenuextension-pro.html
                      • qtdesigner-taskmenuextension-tictactoe-cpp.html
                      • qtdesigner-taskmenuextension-tictactoe-h.html
                      • qtdesigner-taskmenuextension-tictactoedialog-cpp.html
                      • qtdesigner-taskmenuextension-tictactoedialog-h.html
                      • qtdesigner-taskmenuextension-tictactoeplugin-cpp.html
                      • qtdesigner-taskmenuextension-tictactoeplugin-h.html
                      • qtdesigner-taskmenuextension-tictactoetaskmenu-cpp.html
                      • qtdesigner-taskmenuextension-tictactoetaskmenu-h.html
                      • qtdesigner-worldtimeclockbuilder-example.html
                      • qtdesigner-worldtimeclockbuilder-form-ui.html
                      • qtdesigner-worldtimeclockbuilder-main-cpp.html
                      • qtdesigner-worldtimeclockbuilder-worldtimeclockbuilder-pro.html
                      • qtdesigner-worldtimeclockbuilder-worldtimeclockbuilder-qrc.html
                      • qtdesigner-worldtimeclockplugin-example.html
                      • qtdesigner-worldtimeclockplugin-worldtimeclock-cpp.html
                      • qtdesigner-worldtimeclockplugin-worldtimeclock-h.html
                      • qtdesigner-worldtimeclockplugin-worldtimeclockplugin-cpp.html
                      • qtdesigner-worldtimeclockplugin-worldtimeclockplugin-h.html
                      • qtdesigner-worldtimeclockplugin-worldtimeclockplugin-pro.html
                      • qtdesigner.index
                      • qtdesigner.qhp
                      • qtdesigner.qhp.sha1
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtdoc.qch
                    • qtdoc
                      • 3rdparty.html
                      • accelerators.html
                      • accessibility.html
                      • accessible-qtquick.html
                      • accessible-qwidget.html
                      • accessible.html
                      • activeqt-idc.html
                      • activeqt-testcon.html
                      • all-examples.html
                      • android-runtime-licensing-notes.html
                      • android-support.html
                      • android3rdpartylibs.html
                      • androidgs.html
                      • androidservices.html
                      • annotated.html
                      • appicon.html
                      • atomic-operations.html
                      • best-practices.html
                      • bughowto.html
                      • build-sources.html
                      • building-from-source-ios.html
                      • classes.html
                      • classesandfunctions.html
                      • cmake-manual.html
                      • commerciallicense.html
                      • configure-options.html
                      • debug.html
                      • deployment-android.html
                      • deployment-plugins.html
                      • deployment.html
                      • desktop-integration.html
                      • embedded-linux.html
                      • examples-activeqt.html
                      • examples-android.html
                      • examples-animation.html
                      • examples-draganddrop.html
                      • examples-gestures.html
                      • examples-ios.html
                      • examples-ipc.html
                      • examples-layouts.html
                      • examples-sql.html
                      • examples-statemachine.html
                      • examples-threadandconcurrent.html
                      • examples-widgets-tools.html
                      • examples-xml.html
                      • exceptionsafety.html
                      • fdl.html
                      • functions.html
                      • gettingstarted.html
                      • gettingstartedqml.html
                      • gettingstartedqt.html
                      • gpl.html
                      • groups.html
                      • hierarchy.html
                      • highdpi.html
                      • i18n-plural-rules.html
                      • i18n-source-translation.html
                      • i18n.html
                      • images
                        • accessibleobjecttree.png
                        • activeqt-examples.png
                        • animatedtiles_snapshot.png
                        • animation-examples.png
                        • applicationwindow.png
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • controlstexteditor_designer.png
                        • controlstexteditor_main.png
                        • controlstexteditor_navigator.png
                        • controlstexteditor_newproperties.png
                        • controlstexteditor_openproperties.png
                        • controlstexteditor_rowproperties.png
                        • deployment-mac-application.png
                        • deployment-mac-bundlestructure.png
                        • deployment-windows-depends.png
                        • draganddrop-examples.png
                        • flickr_application.png
                        • gs-project1.png
                        • gs-project2.png
                        • gs1.png
                        • gs2.png
                        • gs3.png
                        • gs4.png
                        • gs5.png
                        • home.png
                        • icon_QtCreator_78x78px.png
                        • icon_Qt_78x78px.png
                        • icon_Tools.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • layout-examples.png
                        • logo.png
                        • qml-extending-types.png
                        • qml-texteditor1_button.png
                        • qml-texteditor1_editmenu.png
                        • qml-texteditor1_filemenu.png
                        • qml-texteditor1_simplebutton.png
                        • qml-texteditor2_menubar.png
                        • qml-texteditor3_texteditor.png
                        • qml-texteditor4_texteditor.png
                        • qml-texteditor5_editmenu.png
                        • qml-texteditor5_filemenu.png
                        • qml-texteditor5_newfile.png
                        • qml-uses-animation.png
                        • qml-uses-integratingjs.png
                        • qml-uses-layouts-anchors.png
                        • qml-uses-layouts-direct.png
                        • qml-uses-layouts-positioners.png
                        • qml-uses-text.png
                        • qml-uses-visual-opacity.png
                        • qml-uses-visual-rectangles.png
                        • qml-uses-visual-transforms.png
                        • qt-codesample.png
                        • qt-creator-gs.png
                        • qt-embedded-fontfeatures.png
                        • qt5_everywhere_demo.jpg
                        • qt5_graphicaleffects.jpg
                        • qt5_particles.jpg
                        • qt5_shadereffect.jpg
                        • qt5_video.jpg
                        • qt5_widgets.jpg
                        • qtcreator-run.png
                        • qtlocation-mapviewer-demo.jpg
                        • qtpositioning_weatherinfo_ex.jpg
                        • qtquickcontrols-example-gallery-android.png
                        • qtquickcontrols-example-gallery-osx.png
                        • qtsensors_accelbubble_ex.jpg
                        • qtwebengine_quicknanobrowser.jpg
                        • scalability-gridlayout.png
                        • session.png
                        • sql-examples.png
                        • thread-examples.png
                        • threadsandobjects.png
                        • threadvisual-example.png
                        • tool-examples.png
                        • xml-examples.png
                      • index.html
                      • internationalization.html
                      • ios-support.html
                      • ipc.html
                      • known-issues.html
                      • lgpl.html
                      • licenses-fonts.html
                      • licenses.html
                      • licensing.html
                      • linux-building.html
                      • linux-deployment.html
                      • linux-issues.html
                      • linux-requirements.html
                      • linux.html
                      • mac-licensing.html
                      • mobiledevelopment.html
                      • moc.html
                      • modules-cpp.html
                      • modules-qml.html
                      • modules.html
                      • namespaces.html
                      • newclasses51.html
                      • newclasses52.html
                      • newclasses53.html
                      • newclasses54.html
                      • newclasses55.html
                      • newclasses56.html
                      • newclasses57.html
                      • obsoleteclasses.html
                      • obsoleteqmltypes.html
                      • opensourcelicense.html
                      • opensslsupport.html
                      • osx-building.html
                      • osx-deployment.html
                      • osx-issues.html
                      • osx-requirements.html
                      • osx.html
                      • overviews-main.html
                      • overviews.html
                      • platform-notes-android.html
                      • platform-notes-integrity.html
                      • platform-notes-ios.html
                      • platform-notes-qnx.html
                      • platform-notes-vxworks.html
                      • plugins-howto.html
                      • porting-to-ios.html
                      • portingcppapp.html
                      • portingguide.html
                      • portingqmlapp.html
                      • portingtoandroid.html
                      • publishtogoogleplay.html
                      • qml-codingconventions.html
                      • qml-glossary.html
                      • qmlapplications.html
                      • qmlbasictypes.html
                      • qmlfirststeps.html
                      • qmltypes.html
                      • qpa.html
                      • qt-activex.html
                      • qt-conf.html
                      • qt-embedded-fonts.html
                      • qt-embedded-kmap2qmap.html
                      • qt-embedded-makeqpf.html
                      • qt-gui-concepts.html
                      • qt5-intro.html
                      • qtconcurrent-mtexamples.html
                      • qtconcurrentexamples.html
                      • qtdoc.index
                      • qtdoc.qhp
                      • qtdoc.qhp.sha1
                      • qtexamples.html
                      • qtexamplesandtutorials.html
                      • qtmain.html
                      • qtmodules.html
                      • qtquick-debugging.html
                      • qtquick-deployment.html
                      • qtquick-internationalization.html
                      • qtquick-performance.html
                      • qtquick-porting-qt5.html
                      • qtquick-qmlscene.html
                      • qtquick-qtquicktest.html
                      • qtquick-usecase-animations.html
                      • qtquick-usecase-integratingjs.html
                      • qtquick-usecase-layouts.html
                      • qtquick-usecase-styling.html
                      • qtquick-usecase-text.html
                      • qtquick-usecase-userinput.html
                      • qtquick-usecase-visual.html
                      • qtquickcontrols-texteditor-action.html
                      • qtquickcontrols-texteditor-logic.html
                      • qtquickcontrols-texteditor-ui.html
                      • qtquickcontrols-texteditor.html
                      • qundo.html
                      • rcc.html
                      • reference-overview.html
                      • restoring-geometry.html
                      • scalability.html
                      • session.html
                      • sharedlibrary.html
                      • signalsandslots-syntaxes.html
                      • sourcebreaks.html
                      • sql-examples.html
                      • string-processing.html
                      • style
                        • offline-simple.css
                        • offline.css
                        • qt5-sidebar.html
                      • supported-platforms-and-configurations.html
                      • supported-platforms.html
                      • testing-and-debugging.html
                      • third-party-libraries.html
                      • thread-basics.html
                      • thread.html
                      • threads-modules.html
                      • threads-qobject.html
                      • threads-reentrancy.html
                      • threads-synchronizing.html
                      • threads-technologies.html
                      • threads.html
                      • topics-app-development.html
                      • topics-core.html
                      • topics-data-storage.html
                      • topics-graphics.html
                      • topics-network-connectivity.html
                      • topics-scripting.html
                      • topics-ui.html
                      • topics-web-content.html
                      • touchinputexamples.html
                      • trademarks.html
                      • uic.html
                      • unicode.html
                      • unix-signals.html
                      • whatsnew50.html
                      • whatsnew51.html
                      • whatsnew52.html
                      • whatsnew53.html
                      • whatsnew54.html
                      • whatsnew55.html
                      • whatsnew56.html
                      • whatsnew57.html
                      • why-moc.html
                      • windows-building.html
                      • windows-deployment.html
                      • windows-issues.html
                      • windows-requirements.html
                      • windows-support.html
                      • winrt-support.html
                      • xml-examples.html
                    • qtgamepad.qch
                    • qtgamepad
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • configuregamepadbuttons-example.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • keynavigationgamepad-example.png
                        • logo.png
                        • qtquickgamepad-example.png
                      • qgamepad-members.html
                      • qgamepad.html
                      • qtgamepad-configurebuttons-android-androidmanifest-xml.html
                      • qtgamepad-configurebuttons-configurebuttons-pro.html
                      • qtgamepad-configurebuttons-example.html
                      • qtgamepad-configurebuttons-main-cpp.html
                      • qtgamepad-configurebuttons-main-qml.html
                      • qtgamepad-configurebuttons-qml-qrc.html
                      • qtgamepad-examples.html
                      • qtgamepad-index.html
                      • qtgamepad-keynavigation-example.html
                      • qtgamepad-keynavigation-keynavigation-pro.html
                      • qtgamepad-keynavigation-main-cpp.html
                      • qtgamepad-keynavigation-qml-main-qml.html
                      • qtgamepad-keynavigation-qml-qrc.html
                      • qtgamepad-module.html
                      • qtgamepad-mouseitem-example.html
                      • qtgamepad-mouseitem-main-cpp.html
                      • qtgamepad-mouseitem-mouseitem-pro.html
                      • qtgamepad-mouseitem-qml-main-qml.html
                      • qtgamepad-mouseitem-qml-qrc.html
                      • qtgamepad-qmlmodule.html
                      • qtgamepad-quickgamepad-example.html
                      • qtgamepad-quickgamepad-main-cpp.html
                      • qtgamepad-quickgamepad-qml-buttonimage-qml.html
                      • qtgamepad-quickgamepad-qml-dpad-qml.html
                      • qtgamepad-quickgamepad-qml-joystickviewer-qml.html
                      • qtgamepad-quickgamepad-qml-leftthumbstick-qml.html
                      • qtgamepad-quickgamepad-qml-main-qml.html
                      • qtgamepad-quickgamepad-qml-qrc.html
                      • qtgamepad-quickgamepad-qml-rightthumbstick-qml.html
                      • qtgamepad-quickgamepad-quickgamepad-pro.html
                      • qtgamepad-simple-android-androidmanifest-xml.html
                      • qtgamepad-simple-example.html
                      • qtgamepad-simple-gamepadmonitor-cpp.html
                      • qtgamepad-simple-gamepadmonitor-h.html
                      • qtgamepad-simple-main-cpp.html
                      • qtgamepad-simple-simple-pro.html
                      • qtgamepad.index
                      • qtgamepad.qhp
                      • qtgamepad.qhp.sha1
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtgraphicaleffects.qch
                    • qtgraphicaleffects
                      • graphicaleffects.html
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • Blend_bug_and_butterfly.png
                        • Blend_mode1.png
                        • Blend_mode10.png
                        • Blend_mode11.png
                        • Blend_mode12.png
                        • Blend_mode13.png
                        • Blend_mode14.png
                        • Blend_mode15.png
                        • Blend_mode16.png
                        • Blend_mode17.png
                        • Blend_mode18.png
                        • Blend_mode19.png
                        • Blend_mode2.png
                        • Blend_mode20.png
                        • Blend_mode21.png
                        • Blend_mode22.png
                        • Blend_mode3.png
                        • Blend_mode4.png
                        • Blend_mode5.png
                        • Blend_mode6.png
                        • Blend_mode7.png
                        • Blend_mode8.png
                        • Blend_mode9.png
                        • BrightnessContrast_brightness1.png
                        • BrightnessContrast_brightness2.png
                        • BrightnessContrast_brightness3.png
                        • BrightnessContrast_bug.png
                        • BrightnessContrast_contrast1.png
                        • BrightnessContrast_contrast2.png
                        • BrightnessContrast_contrast3.png
                        • BrightnessContrast_contrast_graph.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • Colorize_bug.png
                        • Colorize_hue1.png
                        • Colorize_hue2.png
                        • Colorize_hue3.png
                        • Colorize_hue_scale.png
                        • Colorize_lightness1.png
                        • Colorize_lightness2.png
                        • Colorize_lightness3.png
                        • Colorize_saturation1.png
                        • Colorize_saturation2.png
                        • Colorize_saturation3.png
                        • ColorOverlay_butterfly.png
                        • ColorOverlay_color1.png
                        • ColorOverlay_color2.png
                        • ColorOverlay_color3.png
                        • ConicalGradient.png
                        • ConicalGradient_angle1.png
                        • ConicalGradient_angle2.png
                        • ConicalGradient_angle3.png
                        • ConicalGradient_gradient1.png
                        • ConicalGradient_gradient2.png
                        • ConicalGradient_gradient3.png
                        • ConicalGradient_horizontalOffset1.png
                        • ConicalGradient_horizontalOffset2.png
                        • ConicalGradient_horizontalOffset3.png
                        • ConicalGradient_maskSource1.png
                        • ConicalGradient_maskSource2.png
                        • Desaturate_bug.png
                        • Desaturate_desaturation1.png
                        • Desaturate_desaturation2.png
                        • Desaturate_desaturation3.png
                        • DirectionalBlur_angle1.png
                        • DirectionalBlur_angle2.png
                        • DirectionalBlur_angle3.png
                        • DirectionalBlur_bug.png
                        • DirectionalBlur_length1.png
                        • DirectionalBlur_length2.png
                        • DirectionalBlur_length3.png
                        • Displace_bug.png
                        • Displace_displacement1.png
                        • Displace_displacement2.png
                        • Displace_displacement3.png
                        • Displace_map.png
                        • DropShadow-transparentBorder.png
                        • DropShadow_butterfly.png
                        • DropShadow_color1.png
                        • DropShadow_color2.png
                        • DropShadow_color3.png
                        • DropShadow_horizontalOffset1.png
                        • DropShadow_horizontalOffset2.png
                        • DropShadow_horizontalOffset3.png
                        • DropShadow_radius1.png
                        • DropShadow_radius2.png
                        • DropShadow_radius3.png
                        • DropShadow_spread1.png
                        • DropShadow_spread2.png
                        • DropShadow_spread3.png
                        • FastBlur_bug.png
                        • FastBlur_radius1.png
                        • FastBlur_radius2.png
                        • FastBlur_radius3.png
                        • FastBlur_transparentBorder1.png
                        • FastBlur_transparentBorder2.png
                        • GammaAdjust_bug.png
                        • GammaAdjust_gamma1.png
                        • GammaAdjust_gamma1_graph.png
                        • GammaAdjust_gamma2.png
                        • GammaAdjust_gamma2_graph.png
                        • GammaAdjust_gamma3.png
                        • GammaAdjust_gamma3_graph.png
                        • GaussianBlur_bug.png
                        • GaussianBlur_deviation1.png
                        • GaussianBlur_deviation2.png
                        • GaussianBlur_deviation3.png
                        • GaussianBlur_deviation_graph.png
                        • GaussianBlur_radius1.png
                        • GaussianBlur_radius2.png
                        • GaussianBlur_radius3.png
                        • GaussianBlur_transparentBorder1.png
                        • GaussianBlur_transparentBorder2.png
                        • Glow-transparentBorder.png
                        • Glow_butterfly.png
                        • Glow_color1.png
                        • Glow_color2.png
                        • Glow_color3.png
                        • Glow_radius1.png
                        • Glow_radius2.png
                        • Glow_radius3.png
                        • Glow_spread1.png
                        • Glow_spread2.png
                        • Glow_spread3.png
                        • home.png
                        • HueSaturation_bug.png
                        • HueSaturation_hue1.png
                        • HueSaturation_hue2.png
                        • HueSaturation_hue3.png
                        • HueSaturation_lightness1.png
                        • HueSaturation_lightness2.png
                        • HueSaturation_lightness3.png
                        • HueSaturation_saturation1.png
                        • HueSaturation_saturation2.png
                        • HueSaturation_saturation3.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • InnerShadow_butterfly.png
                        • InnerShadow_color1.png
                        • InnerShadow_color2.png
                        • InnerShadow_color3.png
                        • InnerShadow_fast1.png
                        • InnerShadow_fast2.png
                        • InnerShadow_horizontalOffset1.png
                        • InnerShadow_horizontalOffset2.png
                        • InnerShadow_horizontalOffset3.png
                        • InnerShadow_radius1.png
                        • InnerShadow_radius2.png
                        • InnerShadow_radius3.png
                        • InnerShadow_spread1.png
                        • InnerShadow_spread2.png
                        • InnerShadow_spread3.png
                        • LevelAdjust_butterfly.png
                        • LevelAdjust_default_curve.png
                        • LevelAdjust_gamma1.png
                        • LevelAdjust_gamma2.png
                        • LevelAdjust_gamma2_curve.png
                        • LevelAdjust_gamma3.png
                        • LevelAdjust_gamma3_curve.png
                        • LevelAdjust_maximumInput1.png
                        • LevelAdjust_maximumInput2.png
                        • LevelAdjust_maximumInput2_curve.png
                        • LevelAdjust_maximumInput3.png
                        • LevelAdjust_maximumInput3_curve.png
                        • LevelAdjust_maximumOutput1.png
                        • LevelAdjust_maximumOutput2.png
                        • LevelAdjust_maximumOutput2_curve.png
                        • LevelAdjust_maximumOutput3.png
                        • LevelAdjust_maximumOutput3_curve.png
                        • LevelAdjust_minimumInput1.png
                        • LevelAdjust_minimumInput2.png
                        • LevelAdjust_minimumInput2_curve.png
                        • LevelAdjust_minimumInput3.png
                        • LevelAdjust_minimumInput3_curve.png
                        • LevelAdjust_minimumOutput1.png
                        • LevelAdjust_minimumOutput2.png
                        • LevelAdjust_minimumOutput2_curve.png
                        • LevelAdjust_minimumOutput3.png
                        • LevelAdjust_minimumOutput3_curve.png
                        • LinearGradient.png
                        • LinearGradient_end1.png
                        • LinearGradient_end2.png
                        • LinearGradient_end3.png
                        • LinearGradient_gradient1.png
                        • LinearGradient_gradient2.png
                        • LinearGradient_gradient3.png
                        • LinearGradient_maskSource1.png
                        • LinearGradient_maskSource2.png
                        • LinearGradient_start1.png
                        • LinearGradient_start2.png
                        • LinearGradient_start3.png
                        • logo.png
                        • MaskedBlur_bug.png
                        • MaskedBlur_mask.png
                        • MaskedBlur_radius1.png
                        • MaskedBlur_radius2.png
                        • MaskedBlur_radius3.png
                        • OpacityMask_bug.png
                        • OpacityMask_mask.png
                        • Original_bug.png
                        • Original_butterfly.png
                        • Original_butterfly_black.png
                        • RadialBlur_angle1.png
                        • RadialBlur_angle2.png
                        • RadialBlur_angle3.png
                        • RadialBlur_bug.png
                        • RadialBlur_horizontalOffset1.png
                        • RadialBlur_horizontalOffset2.png
                        • RadialBlur_horizontalOffset3.png
                        • RadialGradient.png
                        • RadialGradient_angle1.png
                        • RadialGradient_angle2.png
                        • RadialGradient_angle3.png
                        • RadialGradient_gradient1.png
                        • RadialGradient_gradient2.png
                        • RadialGradient_gradient3.png
                        • RadialGradient_horizontalOffset1.png
                        • RadialGradient_horizontalOffset2.png
                        • RadialGradient_horizontalOffset3.png
                        • RadialGradient_horizontalRadius1.png
                        • RadialGradient_horizontalRadius2.png
                        • RadialGradient_maskSource1.png
                        • RadialGradient_maskSource2.png
                        • RectangularGlow_applied.png
                        • RectangularGlow_color1.png
                        • RectangularGlow_color2.png
                        • RectangularGlow_color3.png
                        • RectangularGlow_cornerRadius1.png
                        • RectangularGlow_cornerRadius2.png
                        • RectangularGlow_cornerRadius3.png
                        • RectangularGlow_glowRadius1.png
                        • RectangularGlow_glowRadius2.png
                        • RectangularGlow_glowRadius3.png
                        • RectangularGlow_spread1.png
                        • RectangularGlow_spread2.png
                        • RectangularGlow_spread3.png
                        • RecursiveBlur_bug.png
                        • RecursiveBlur_loops1.png
                        • RecursiveBlur_loops2.png
                        • RecursiveBlur_loops3.png
                        • RecursiveBlur_radius1.png
                        • RecursiveBlur_radius2.png
                        • RecursiveBlur_radius3.png
                        • RecursiveBlur_transparentBorder1.png
                        • RecursiveBlur_transparentBorder2.png
                        • ThresholdMask_bug.png
                        • ThresholdMask_mask.png
                        • ThresholdMask_spread1.png
                        • ThresholdMask_spread2.png
                        • ThresholdMask_spread3.png
                        • ThresholdMask_threshold1.png
                        • ThresholdMask_threshold2.png
                        • ThresholdMask_threshold3.png
                        • ZoomBlur_bug.png
                        • ZoomBlur_horizontalOffset1.png
                        • ZoomBlur_horizontalOffset2.png
                        • ZoomBlur_horizontalOffset3.png
                        • ZoomBlur_length1.png
                        • ZoomBlur_length2.png
                        • ZoomBlur_length3.png
                      • qml-qtgraphicaleffects-blend-members.html
                      • qml-qtgraphicaleffects-blend.html
                      • qml-qtgraphicaleffects-brightnesscontrast-members.html
                      • qml-qtgraphicaleffects-brightnesscontrast.html
                      • qml-qtgraphicaleffects-colorize-members.html
                      • qml-qtgraphicaleffects-colorize.html
                      • qml-qtgraphicaleffects-coloroverlay-members.html
                      • qml-qtgraphicaleffects-coloroverlay.html
                      • qml-qtgraphicaleffects-conicalgradient-members.html
                      • qml-qtgraphicaleffects-conicalgradient.html
                      • qml-qtgraphicaleffects-desaturate-members.html
                      • qml-qtgraphicaleffects-desaturate.html
                      • qml-qtgraphicaleffects-directionalblur-members.html
                      • qml-qtgraphicaleffects-directionalblur.html
                      • qml-qtgraphicaleffects-displace-members.html
                      • qml-qtgraphicaleffects-displace.html
                      • qml-qtgraphicaleffects-dropshadow-members.html
                      • qml-qtgraphicaleffects-dropshadow.html
                      • qml-qtgraphicaleffects-fastblur-members.html
                      • qml-qtgraphicaleffects-fastblur.html
                      • qml-qtgraphicaleffects-gammaadjust-members.html
                      • qml-qtgraphicaleffects-gammaadjust.html
                      • qml-qtgraphicaleffects-gaussianblur-members.html
                      • qml-qtgraphicaleffects-gaussianblur.html
                      • qml-qtgraphicaleffects-glow-members.html
                      • qml-qtgraphicaleffects-glow.html
                      • qml-qtgraphicaleffects-huesaturation-members.html
                      • qml-qtgraphicaleffects-huesaturation.html
                      • qml-qtgraphicaleffects-innershadow-members.html
                      • qml-qtgraphicaleffects-innershadow.html
                      • qml-qtgraphicaleffects-leveladjust-members.html
                      • qml-qtgraphicaleffects-leveladjust.html
                      • qml-qtgraphicaleffects-lineargradient-members.html
                      • qml-qtgraphicaleffects-lineargradient.html
                      • qml-qtgraphicaleffects-maskedblur-members.html
                      • qml-qtgraphicaleffects-maskedblur.html
                      • qml-qtgraphicaleffects-opacitymask-members.html
                      • qml-qtgraphicaleffects-opacitymask.html
                      • qml-qtgraphicaleffects-radialblur-members.html
                      • qml-qtgraphicaleffects-radialblur.html
                      • qml-qtgraphicaleffects-radialgradient-members.html
                      • qml-qtgraphicaleffects-radialgradient.html
                      • qml-qtgraphicaleffects-rectangularglow-members.html
                      • qml-qtgraphicaleffects-rectangularglow.html
                      • qml-qtgraphicaleffects-recursiveblur-members.html
                      • qml-qtgraphicaleffects-recursiveblur.html
                      • qml-qtgraphicaleffects-thresholdmask-members.html
                      • qml-qtgraphicaleffects-thresholdmask.html
                      • qml-qtgraphicaleffects-zoomblur-members.html
                      • qml-qtgraphicaleffects-zoomblur.html
                      • qtgraphicaleffects-index.html
                      • qtgraphicaleffects-qmlmodule.html
                      • qtgraphicaleffects.index
                      • qtgraphicaleffects.qhp
                      • qtgraphicaleffects.qhp.sha1
                      • qtgraphicaleffects.tags
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtgui.qch
                    • qtgui
                      • coordsys.html
                      • dnd.html
                      • examples-manifest.xml
                      • images
                        • alphafill.png
                        • analogclock-window-example.png
                        • analogclockwindow-viewport.png
                        • arrow_bc.png
                        • bearings.png
                        • bgrContent.png
                        • brush-outline.png
                        • brush-styles.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • coordinatesystem-analogclock.png
                        • coordinatesystem-line-antialias.png
                        • coordinatesystem-line-raster.png
                        • coordinatesystem-line.png
                        • coordinatesystem-rect-antialias.png
                        • coordinatesystem-rect-raster.png
                        • coordinatesystem-rect.png
                        • coordinatesystem-transformations.png
                        • cursor-arrow.png
                        • cursor-busy.png
                        • cursor-closedhand.png
                        • cursor-cross.png
                        • cursor-forbidden.png
                        • cursor-hand.png
                        • cursor-hsplit.png
                        • cursor-ibeam.png
                        • cursor-openhand.png
                        • cursor-sizeall.png
                        • cursor-sizeb.png
                        • cursor-sizef.png
                        • cursor-sizeh.png
                        • cursor-sizev.png
                        • cursor-uparrow.png
                        • cursor-vsplit.png
                        • cursor-wait.png
                        • cursor-whatsthis.png
                        • home.png
                        • hoverevents.png
                        • icon.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • openglwindow-example.png
                        • paintsystem-antialiasing.png
                        • paintsystem-core.png
                        • paintsystem-fancygradient.png
                        • paintsystem-gradients.png
                        • paintsystem-movie.png
                        • paintsystem-painterpath.png
                        • palette.png
                        • plaintext-layout.png
                        • qcolor-cmyk.png
                        • qcolor-hsv.png
                        • qcolor-hue.png
                        • qcolor-rgb.png
                        • qcolor-saturation.png
                        • qcolor-value.png
                        • qconicalgradient.png
                        • qgradient-conical.png
                        • qgradient-linear.png
                        • qgradient-radial.png
                        • qimage-32bit_scaled.png
                        • qimage-8bit_scaled.png
                        • qimage-scaling.png
                        • qlineargradient-pad.png
                        • qlineargradient-reflect.png
                        • qlineargradient-repeat.png
                        • qmatrix-combinedtransformation.png
                        • qmatrix-representation.png
                        • qmatrix-simpletransformation.png
                        • qpainter-affinetransformations.png
                        • qpainter-arc.png
                        • qpainter-basicdrawing.png
                        • qpainter-chord.png
                        • qpainter-clock.png
                        • qpainter-compositiondemo.png
                        • qpainter-compositionmode1.png
                        • qpainter-compositionmode2.png
                        • qpainter-concentriccircles.png
                        • qpainter-ellipse.png
                        • qpainter-gradients.png
                        • qpainter-line.png
                        • qpainter-painterpaths.png
                        • qpainter-path.png
                        • qpainter-pathstroking.png
                        • qpainter-pie.png
                        • qpainter-polygon.png
                        • qpainter-rectangle.png
                        • qpainter-rotation.png
                        • qpainter-roundrect.png
                        • qpainter-scale.png
                        • qpainter-text-bounds.png
                        • qpainter-text.png
                        • qpainter-translation.png
                        • qpainter-vectordeformation.png
                        • qpainterpath-addellipse.png
                        • qpainterpath-addpolygon.png
                        • qpainterpath-addrectangle.png
                        • qpainterpath-addtext.png
                        • qpainterpath-arcto.png
                        • qpainterpath-construction.png
                        • qpainterpath-cubicto.png
                        • qpainterpath-demo.png
                        • qpainterpath-example.png
                        • qpen-bevel.png
                        • qpen-custom.png
                        • qpen-dash.png
                        • qpen-dashdot.png
                        • qpen-dashdotdot.png
                        • qpen-dashpattern.png
                        • qpen-demo.png
                        • qpen-dot.png
                        • qpen-flat.png
                        • qpen-miter.png
                        • qpen-miterlimit.png
                        • qpen-roundcap.png
                        • qpen-roundjoin.png
                        • qpen-solid.png
                        • qpen-square.png
                        • qpixelformat-argb32buffer.png
                        • qradialgradient-pad.png
                        • qradialgradient-reflect.png
                        • qradialgradient-repeat.png
                        • qrect-diagram-zero.png
                        • qrectf-diagram-one.png
                        • qrectf-diagram-three.png
                        • qrectf-diagram-two.png
                        • qstatustipevent-action.png
                        • qstatustipevent-widget.png
                        • qt-colors.png
                        • qt-fillrule-oddeven.png
                        • qt-fillrule-winding.png
                        • qtabletevent-tilt.png
                        • qtextblock-sequence.png
                        • qtextfragment-split.png
                        • qtextframe-style.png
                        • qtexttableformat-cell.png
                        • qtransform-combinedtransformation.png
                        • qtransform-combinedtransformation2.png
                        • qtransform-representation.png
                        • qtransform-simpletransformation.png
                        • richtext-document.png
                        • rintersect.png
                        • rsubtract.png
                        • runion.png
                        • rxor.png
                        • texttable-merge.png
                        • texttable-split.png
                      • painting-3d.html
                      • painting.html
                      • paintsystem-devices.html
                      • paintsystem-drawing.html
                      • paintsystem-images.html
                      • paintsystem.html
                      • qabstractopenglfunctions-members.html
                      • qabstractopenglfunctions.html
                      • qabstracttextdocumentlayout-members.html
                      • qabstracttextdocumentlayout-paintcontext-members.html
                      • qabstracttextdocumentlayout-paintcontext.html
                      • qabstracttextdocumentlayout-selection-members.html
                      • qabstracttextdocumentlayout-selection.html
                      • qabstracttextdocumentlayout.html
                      • qaccessible-members.html
                      • qaccessible-obsolete.html
                      • qaccessible-state-members.html
                      • qaccessible-state.html
                      • qaccessible.html
                      • qaccessibleactioninterface-members.html
                      • qaccessibleactioninterface.html
                      • qaccessibleeditabletextinterface-members.html
                      • qaccessibleeditabletextinterface.html
                      • qaccessibleevent-members.html
                      • qaccessibleevent.html
                      • qaccessibleinterface-members.html
                      • qaccessibleinterface.html
                      • qaccessibleobject-members.html
                      • qaccessibleobject.html
                      • qaccessibleplugin-members.html
                      • qaccessibleplugin.html
                      • qaccessiblestatechangeevent-members.html
                      • qaccessiblestatechangeevent.html
                      • qaccessibletablecellinterface-members.html
                      • qaccessibletablecellinterface.html
                      • qaccessibletableinterface-members.html
                      • qaccessibletableinterface.html
                      • qaccessibletablemodelchangeevent-members.html
                      • qaccessibletablemodelchangeevent.html
                      • qaccessibletextcursorevent-members.html
                      • qaccessibletextcursorevent.html
                      • qaccessibletextinsertevent-members.html
                      • qaccessibletextinsertevent.html
                      • qaccessibletextinterface-members.html
                      • qaccessibletextinterface.html
                      • qaccessibletextremoveevent-members.html
                      • qaccessibletextremoveevent.html
                      • qaccessibletextselectionevent-members.html
                      • qaccessibletextselectionevent.html
                      • qaccessibletextupdateevent-members.html
                      • qaccessibletextupdateevent.html
                      • qaccessiblevaluechangeevent-members.html
                      • qaccessiblevaluechangeevent.html
                      • qaccessiblevalueinterface-members.html
                      • qaccessiblevalueinterface.html
                      • qactionevent-members.html
                      • qactionevent.html
                      • qbackingstore-members.html
                      • qbackingstore.html
                      • qbitmap-members.html
                      • qbitmap-obsolete.html
                      • qbitmap.html
                      • qbrush-members.html
                      • qbrush.html
                      • qclipboard-members.html
                      • qclipboard.html
                      • qcloseevent-members.html
                      • qcloseevent.html
                      • qcolor-members.html
                      • qcolor-obsolete.html
                      • qcolor.html
                      • qconicalgradient-members.html
                      • qconicalgradient.html
                      • qcontextmenuevent-members.html
                      • qcontextmenuevent.html
                      • qcursor-members.html
                      • qcursor.html
                      • qdesktopservices-members.html
                      • qdesktopservices-obsolete.html
                      • qdesktopservices.html
                      • qdoublevalidator-members.html
                      • qdoublevalidator.html
                      • qdrag-members.html
                      • qdrag-obsolete.html
                      • qdrag.html
                      • qdragenterevent-members.html
                      • qdragenterevent.html
                      • qdragleaveevent-members.html
                      • qdragleaveevent.html
                      • qdragmoveevent-members.html
                      • qdragmoveevent.html
                      • qdropevent-members.html
                      • qdropevent.html
                      • qenterevent-members.html
                      • qenterevent.html
                      • qexposeevent-members.html
                      • qexposeevent.html
                      • qfileopenevent-members.html
                      • qfileopenevent.html
                      • qfocusevent-members.html
                      • qfocusevent.html
                      • qfont-members.html
                      • qfont-obsolete.html
                      • qfont.html
                      • qfontdatabase-members.html
                      • qfontdatabase-obsolete.html
                      • qfontdatabase.html
                      • qfontinfo-members.html
                      • qfontinfo-obsolete.html
                      • qfontinfo.html
                      • qfontmetrics-members.html
                      • qfontmetrics-obsolete.html
                      • qfontmetrics.html
                      • qfontmetricsf-members.html
                      • qfontmetricsf.html
                      • qgenericmatrix-members.html
                      • qgenericmatrix.html
                      • qgenericplugin-members.html
                      • qgenericplugin.html
                      • qgenericpluginfactory-members.html
                      • qgenericpluginfactory.html
                      • qglyphrun-members.html
                      • qglyphrun.html
                      • qgradient-members.html
                      • qgradient.html
                      • qguiapplication-members.html
                      • qguiapplication.html
                      • qhelpevent-members.html
                      • qhelpevent.html
                      • qhideevent-members.html
                      • qhideevent.html
                      • qhoverevent-members.html
                      • qhoverevent.html
                      • qicon-members.html
                      • qicon-obsolete.html
                      • qicon.html
                      • qicondragevent-members.html
                      • qicondragevent.html
                      • qiconengine-availablesizesargument-members.html
                      • qiconengine-availablesizesargument.html
                      • qiconengine-members.html
                      • qiconengine.html
                      • qiconengineplugin-members.html
                      • qiconengineplugin.html
                      • qimage-members.html
                      • qimage-obsolete.html
                      • qimage.html
                      • qimageiohandler-members.html
                      • qimageiohandler-obsolete.html
                      • qimageiohandler.html
                      • qimageioplugin-members.html
                      • qimageioplugin.html
                      • qimagereader-members.html
                      • qimagereader.html
                      • qimagewriter-members.html
                      • qimagewriter-obsolete.html
                      • qimagewriter.html
                      • qinputevent-members.html
                      • qinputevent.html
                      • qinputmethod-members.html
                      • qinputmethod.html
                      • qinputmethodevent-attribute-members.html
                      • qinputmethodevent-attribute.html
                      • qinputmethodevent-members.html
                      • qinputmethodevent.html
                      • qinputmethodqueryevent-members.html
                      • qinputmethodqueryevent.html
                      • qintvalidator-members.html
                      • qintvalidator.html
                      • qkeyevent-members.html
                      • qkeyevent.html
                      • qkeysequence-members.html
                      • qkeysequence-obsolete.html
                      • qkeysequence.html
                      • qlineargradient-members.html
                      • qlineargradient.html
                      • qmatrix-members.html
                      • qmatrix.html
                      • qmatrix4x4-members.html
                      • qmatrix4x4-obsolete.html
                      • qmatrix4x4.html
                      • qmouseevent-members.html
                      • qmouseevent-obsolete.html
                      • qmouseevent.html
                      • qmoveevent-members.html
                      • qmoveevent.html
                      • qmovie-members.html
                      • qmovie.html
                      • qnativegestureevent-members.html
                      • qnativegestureevent.html
                      • qoffscreensurface-members.html
                      • qoffscreensurface.html
                      • qopenglbuffer-members.html
                      • qopenglbuffer.html
                      • qopenglcontext-members.html
                      • qopenglcontext.html
                      • qopenglcontextgroup-members.html
                      • qopenglcontextgroup.html
                      • qopengldebuglogger-members.html
                      • qopengldebuglogger.html
                      • qopengldebugmessage-members.html
                      • qopengldebugmessage.html
                      • qopenglextrafunctions-members.html
                      • qopenglextrafunctions.html
                      • qopenglframebufferobject-members.html
                      • qopenglframebufferobject.html
                      • qopenglframebufferobjectformat-members.html
                      • qopenglframebufferobjectformat.html
                      • qopenglfunctions-1-0-members.html
                      • qopenglfunctions-1-0.html
                      • qopenglfunctions-1-1-members.html
                      • qopenglfunctions-1-1.html
                      • qopenglfunctions-1-2-members.html
                      • qopenglfunctions-1-2.html
                      • qopenglfunctions-1-3-members.html
                      • qopenglfunctions-1-3.html
                      • qopenglfunctions-1-4-members.html
                      • qopenglfunctions-1-4.html
                      • qopenglfunctions-1-5-members.html
                      • qopenglfunctions-1-5.html
                      • qopenglfunctions-2-0-members.html
                      • qopenglfunctions-2-0.html
                      • qopenglfunctions-2-1-members.html
                      • qopenglfunctions-2-1.html
                      • qopenglfunctions-3-0-members.html
                      • qopenglfunctions-3-0.html
                      • qopenglfunctions-3-1-members.html
                      • qopenglfunctions-3-1.html
                      • qopenglfunctions-3-2-compatibility-members.html
                      • qopenglfunctions-3-2-compatibility.html
                      • qopenglfunctions-3-2-core-members.html
                      • qopenglfunctions-3-2-core.html
                      • qopenglfunctions-3-3-compatibility-members.html
                      • qopenglfunctions-3-3-compatibility.html
                      • qopenglfunctions-3-3-core-members.html
                      • qopenglfunctions-3-3-core.html
                      • qopenglfunctions-4-0-compatibility-members.html
                      • qopenglfunctions-4-0-compatibility.html
                      • qopenglfunctions-4-0-core-members.html
                      • qopenglfunctions-4-0-core.html
                      • qopenglfunctions-4-1-compatibility-members.html
                      • qopenglfunctions-4-1-compatibility.html
                      • qopenglfunctions-4-1-core-members.html
                      • qopenglfunctions-4-1-core.html
                      • qopenglfunctions-4-2-compatibility-members.html
                      • qopenglfunctions-4-2-compatibility.html
                      • qopenglfunctions-4-2-core-members.html
                      • qopenglfunctions-4-2-core.html
                      • qopenglfunctions-4-3-compatibility-members.html
                      • qopenglfunctions-4-3-compatibility.html
                      • qopenglfunctions-4-3-core-members.html
                      • qopenglfunctions-4-3-core.html
                      • qopenglfunctions-4-4-compatibility-members.html
                      • qopenglfunctions-4-4-compatibility.html
                      • qopenglfunctions-4-4-core-members.html
                      • qopenglfunctions-4-4-core.html
                      • qopenglfunctions-4-5-compatibility-members.html
                      • qopenglfunctions-4-5-compatibility.html
                      • qopenglfunctions-4-5-core-members.html
                      • qopenglfunctions-4-5-core.html
                      • qopenglfunctions-es2-members.html
                      • qopenglfunctions-es2.html
                      • qopenglfunctions-members.html
                      • qopenglfunctions-obsolete.html
                      • qopenglfunctions.html
                      • qopenglpaintdevice-members.html
                      • qopenglpaintdevice.html
                      • qopenglpixeltransferoptions-members.html
                      • qopenglpixeltransferoptions.html
                      • qopenglshader-members.html
                      • qopenglshader.html
                      • qopenglshaderprogram-members.html
                      • qopenglshaderprogram.html
                      • qopengltexture-members.html
                      • qopengltexture-obsolete.html
                      • qopengltexture.html
                      • qopengltimemonitor-members.html
                      • qopengltimemonitor.html
                      • qopengltimerquery-members.html
                      • qopengltimerquery.html
                      • qopenglversionprofile-members.html
                      • qopenglversionprofile.html
                      • qopenglvertexarrayobject-binder-members.html
                      • qopenglvertexarrayobject-binder.html
                      • qopenglvertexarrayobject-members.html
                      • qopenglvertexarrayobject.html
                      • qopenglwindow-members.html
                      • qopenglwindow.html
                      • qpagedpaintdevice-margins-members.html
                      • qpagedpaintdevice-margins.html
                      • qpagedpaintdevice-members.html
                      • qpagedpaintdevice.html
                      • qpagelayout-members.html
                      • qpagelayout.html
                      • qpagesize-members.html
                      • qpagesize.html
                      • qpaintdevice-members.html
                      • qpaintdevice.html
                      • qpaintdevicewindow-members.html
                      • qpaintdevicewindow.html
                      • qpaintengine-members.html
                      • qpaintengine.html
                      • qpaintenginestate-members.html
                      • qpaintenginestate-obsolete.html
                      • qpaintenginestate.html
                      • qpainter-members.html
                      • qpainter-obsolete.html
                      • qpainter-pixmapfragment-members.html
                      • qpainter-pixmapfragment.html
                      • qpainter.html
                      • qpainterpath-element-members.html
                      • qpainterpath-element.html
                      • qpainterpath-members.html
                      • qpainterpath-obsolete.html
                      • qpainterpath.html
                      • qpainterpathstroker-members.html
                      • qpainterpathstroker.html
                      • qpaintevent-members.html
                      • qpaintevent.html
                      • qpalette-members.html
                      • qpalette-obsolete.html
                      • qpalette.html
                      • qpdfwriter-members.html
                      • qpdfwriter-obsolete.html
                      • qpdfwriter.html
                      • qpen-members.html
                      • qpen.html
                      • qpicture-members.html
                      • qpicture-obsolete.html
                      • qpicture.html
                      • qpictureformatplugin-members.html
                      • qpictureformatplugin.html
                      • qpictureio-members.html
                      • qpictureio.html
                      • qpixelformat-members.html
                      • qpixelformat.html
                      • qpixmap-members.html
                      • qpixmap-obsolete.html
                      • qpixmap.html
                      • qpixmapcache-key-members.html
                      • qpixmapcache-key.html
                      • qpixmapcache-keydata-members.html
                      • qpixmapcache-keydata.html
                      • qpixmapcache-members.html
                      • qpixmapcache-obsolete.html
                      • qpixmapcache.html
                      • qplatformgraphicsbuffer-members.html
                      • qplatformgraphicsbuffer.html
                      • qplatformsurfaceevent-members.html
                      • qplatformsurfaceevent.html
                      • qplatformsystemtrayicon-members.html
                      • qplatformsystemtrayicon.html
                      • qpolygon-members.html
                      • qpolygon.html
                      • qpolygonf-members.html
                      • qpolygonf.html
                      • qquaternion-members.html
                      • qquaternion-obsolete.html
                      • qquaternion.html
                      • qradialgradient-members.html
                      • qradialgradient.html
                      • qrasterpaintengine-members.html
                      • qrasterpaintengine.html
                      • qrasterwindow-members.html
                      • qrasterwindow.html
                      • qrawfont-members.html
                      • qrawfont.html
                      • qregexpvalidator-members.html
                      • qregexpvalidator.html
                      • qregion-members.html
                      • qregion-obsolete.html
                      • qregion.html
                      • qregularexpressionvalidator-members.html
                      • qregularexpressionvalidator.html
                      • qresizeevent-members.html
                      • qresizeevent.html
                      • qrgba64-members.html
                      • qrgba64.html
                      • qscreen-members.html
                      • qscreen.html
                      • qscrollevent-members.html
                      • qscrollevent.html
                      • qscrollprepareevent-members.html
                      • qscrollprepareevent.html
                      • qsessionmanager-members.html
                      • qsessionmanager.html
                      • qshortcutevent-members.html
                      • qshortcutevent.html
                      • qshowevent-members.html
                      • qshowevent.html
                      • qstandarditem-members.html
                      • qstandarditem-obsolete.html
                      • qstandarditem.html
                      • qstandarditemmodel-members.html
                      • qstandarditemmodel.html
                      • qstatictext-members.html
                      • qstatictext.html
                      • qstatustipevent-members.html
                      • qstatustipevent.html
                      • qstylehints-members.html
                      • qstylehints.html
                      • qsupportedwritingsystems-members.html
                      • qsupportedwritingsystems.html
                      • qsurface-members.html
                      • qsurface.html
                      • qsurfaceformat-members.html
                      • qsurfaceformat-obsolete.html
                      • qsurfaceformat.html
                      • qsyntaxhighlighter-members.html
                      • qsyntaxhighlighter.html
                      • qtabletevent-members.html
                      • qtabletevent-obsolete.html
                      • qtabletevent.html
                      • qtextblock-iterator-members.html
                      • qtextblock-iterator.html
                      • qtextblock-members.html
                      • qtextblock.html
                      • qtextblockformat-members.html
                      • qtextblockformat.html
                      • qtextblockgroup-members.html
                      • qtextblockgroup.html
                      • qtextblockuserdata-members.html
                      • qtextblockuserdata.html
                      • qtextcharformat-members.html
                      • qtextcharformat-obsolete.html
                      • qtextcharformat.html
                      • qtextcursor-members.html
                      • qtextcursor.html
                      • qtextdocument-members.html
                      • qtextdocument.html
                      • qtextdocumentfragment-members.html
                      • qtextdocumentfragment.html
                      • qtextdocumentwriter-members.html
                      • qtextdocumentwriter.html
                      • qtextformat-members.html
                      • qtextformat.html
                      • qtextfragment-members.html
                      • qtextfragment.html
                      • qtextframe-iterator-members.html
                      • qtextframe-iterator.html
                      • qtextframe-members.html
                      • qtextframe.html
                      • qtextframeformat-members.html
                      • qtextframeformat.html
                      • qtextimageformat-members.html
                      • qtextimageformat.html
                      • qtextinlineobject-members.html
                      • qtextinlineobject.html
                      • qtextitem-members.html
                      • qtextitem.html
                      • qtextlayout-formatrange-members.html
                      • qtextlayout-formatrange.html
                      • qtextlayout-members.html
                      • qtextlayout-obsolete.html
                      • qtextlayout.html
                      • qtextlength-members.html
                      • qtextlength.html
                      • qtextline-members.html
                      • qtextline.html
                      • qtextlist-members.html
                      • qtextlist-obsolete.html
                      • qtextlist.html
                      • qtextlistformat-members.html
                      • qtextlistformat.html
                      • qtextobject-members.html
                      • qtextobject.html
                      • qtextobjectinterface-members.html
                      • qtextobjectinterface.html
                      • qtextoption-members.html
                      • qtextoption-tab-members.html
                      • qtextoption-tab.html
                      • qtextoption.html
                      • qtexttable-members.html
                      • qtexttable.html
                      • qtexttablecell-members.html
                      • qtexttablecell.html
                      • qtexttablecellformat-members.html
                      • qtexttablecellformat.html
                      • qtexttableformat-members.html
                      • qtexttableformat.html
                      • qtgui-analogclock-analogclock-pro.html
                      • qtgui-analogclock-example.html
                      • qtgui-analogclock-main-cpp.html
                      • qtgui-index.html
                      • qtgui-module.html
                      • qtgui-openglwindow-example.html
                      • qtgui-openglwindow-main-cpp.html
                      • qtgui-openglwindow-openglwindow-cpp.html
                      • qtgui-openglwindow-openglwindow-h.html
                      • qtgui-openglwindow-openglwindow-pro.html
                      • qtgui-rasterwindow-example.html
                      • qtgui-rasterwindow-main-cpp.html
                      • qtgui-rasterwindow-rasterwindow-cpp.html
                      • qtgui-rasterwindow-rasterwindow-h.html
                      • qtgui-rasterwindow-rasterwindow-pro.html
                      • qtgui.index
                      • qtgui.qhp
                      • qtgui.qhp.sha1
                      • qtgui.tags
                      • qtouchdevice-members.html
                      • qtouchdevice.html
                      • qtouchevent-members.html
                      • qtouchevent-obsolete.html
                      • qtouchevent-touchpoint-members.html
                      • qtouchevent-touchpoint.html
                      • qtouchevent.html
                      • qtransform-members.html
                      • qtransform-obsolete.html
                      • qtransform.html
                      • qvalidator-members.html
                      • qvalidator.html
                      • qvector2d-members.html
                      • qvector2d.html
                      • qvector3d-members.html
                      • qvector3d.html
                      • qvector4d-members.html
                      • qvector4d.html
                      • qwhatsthisclickedevent-members.html
                      • qwhatsthisclickedevent.html
                      • qwheelevent-members.html
                      • qwheelevent-obsolete.html
                      • qwheelevent.html
                      • qwindow-members.html
                      • qwindow.html
                      • qwindowstatechangeevent-members.html
                      • qwindowstatechangeevent.html
                      • richtext-advanced-processing.html
                      • richtext-common-tasks.html
                      • richtext-cursor.html
                      • richtext-html-subset.html
                      • richtext-layouts.html
                      • richtext-processing.html
                      • richtext-structure.html
                      • richtext.html
                      • style
                        • offline-simple.css
                        • offline.css
                    • qthelp.qch
                    • qthelp
                      • examples-manifest.xml
                      • examples-qthelp.html
                      • helpsystem.html
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                      • qhelpcontentitem-members.html
                      • qhelpcontentitem.html
                      • qhelpcontentmodel-members.html
                      • qhelpcontentmodel.html
                      • qhelpcontentwidget-members.html
                      • qhelpcontentwidget.html
                      • qhelpengine-members.html
                      • qhelpengine.html
                      • qhelpenginecore-members.html
                      • qhelpenginecore.html
                      • qhelpindexmodel-members.html
                      • qhelpindexmodel.html
                      • qhelpindexwidget-members.html
                      • qhelpindexwidget.html
                      • qhelpsearchengine-members.html
                      • qhelpsearchengine-obsolete.html
                      • qhelpsearchengine.html
                      • qhelpsearchquery-members.html
                      • qhelpsearchquery.html
                      • qhelpsearchquerywidget-members.html
                      • qhelpsearchquerywidget.html
                      • qhelpsearchresultwidget-members.html
                      • qhelpsearchresultwidget.html
                      • qthelp-contextsensitivehelp-contextsensitivehelp-pro.html
                      • qthelp-contextsensitivehelp-docs-wateringmachine-qhcp.html
                      • qthelp-contextsensitivehelp-docs-wateringmachine-qhp.html
                      • qthelp-contextsensitivehelp-example.html
                      • qthelp-contextsensitivehelp-helpbrowser-cpp.html
                      • qthelp-contextsensitivehelp-helpbrowser-h.html
                      • qthelp-contextsensitivehelp-main-cpp.html
                      • qthelp-contextsensitivehelp-wateringconfigdialog-cpp.html
                      • qthelp-contextsensitivehelp-wateringconfigdialog-h.html
                      • qthelp-contextsensitivehelp-wateringconfigdialog-ui.html
                      • qthelp-framework.html
                      • qthelp-index.html
                      • qthelp-module.html
                      • qthelp.index
                      • qthelp.qhp
                      • qthelp.qhp.sha1
                      • qthelpproject.html
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtimageformats.qch
                    • qtimageformats
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                      • qtimageformats-index.html
                      • qtimageformats.index
                      • qtimageformats.qhp
                      • qtimageformats.qhp.sha1
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtlinguist.qch
                    • qtlinguist
                      • examples-linguist.html
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • linguist-arrowpad_en.png
                        • linguist-arrowpad_fr.png
                        • linguist-arrowpad_nl.png
                        • linguist-batchtranslation.png
                        • linguist-check-empty.png
                        • linguist-check-obsolete.png
                        • linguist-check-off.png
                        • linguist-check-on.png
                        • linguist-check-warning.png
                        • linguist-danger.png
                        • linguist-doneandnext.png
                        • linguist-hellotr_en.png
                        • linguist-hellotr_la.png
                        • linguist-linguist.png
                        • linguist-linguist_2.png
                        • linguist-phrasebookdialog.png
                        • linguist-translationfilesettings.png
                        • linguist-trollprint_10_en.png
                        • linguist-trollprint_10_pt_bad.png
                        • linguist-trollprint_10_pt_good.png
                        • linguist-trollprint_11_en.png
                        • linguist-trollprint_11_pt.png
                        • logo.png
                      • linguist-id-based-i18n.html
                      • linguist-manager.html
                      • linguist-overview.html
                      • linguist-programmers.html
                      • linguist-translators.html
                      • linguist-ts-file-format.html
                      • qtlinguist-arrowpad-arrowpad-cpp.html
                      • qtlinguist-arrowpad-arrowpad-h.html
                      • qtlinguist-arrowpad-arrowpad-pro.html
                      • qtlinguist-arrowpad-example.html
                      • qtlinguist-arrowpad-main-cpp.html
                      • qtlinguist-arrowpad-mainwindow-cpp.html
                      • qtlinguist-arrowpad-mainwindow-h.html
                      • qtlinguist-hellotr-example.html
                      • qtlinguist-hellotr-hellotr-pro.html
                      • qtlinguist-hellotr-main-cpp.html
                      • qtlinguist-index.html
                      • qtlinguist-trollprint-example.html
                      • qtlinguist-trollprint-main-cpp.html
                      • qtlinguist-trollprint-mainwindow-cpp.html
                      • qtlinguist-trollprint-mainwindow-h.html
                      • qtlinguist-trollprint-printpanel-cpp.html
                      • qtlinguist-trollprint-printpanel-h.html
                      • qtlinguist-trollprint-trollprint-pro.html
                      • qtlinguist.index
                      • qtlinguist.qhp
                      • qtlinguist.qhp.sha1
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtlocation.qch
                    • qtlocation
                      • examples-manifest.xml
                      • images
                        • api-mapcircle.png
                        • api-mappolygon.png
                        • api-mappolyline.png
                        • api-mapquickitem-anchor.png
                        • api-mapquickitem.png
                        • api-maprectangle.png
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • mapviewer.png
                        • minimal_map.png
                        • places.png
                        • places_list.png
                        • places_map.png
                        • planespotter.png
                      • location-cpp-qml.html
                      • location-maps-cpp.html
                      • location-maps-qml.html
                      • location-places-backend.html
                      • location-places-cpp.html
                      • location-places-qml.html
                      • location-plugin-here.html
                      • location-plugin-mapbox.html
                      • location-plugin-osm.html
                      • qgeocodereply-members.html
                      • qgeocodereply.html
                      • qgeocodingmanager-members.html
                      • qgeocodingmanager.html
                      • qgeocodingmanagerengine-members.html
                      • qgeocodingmanagerengine.html
                      • qgeomaneuver-members.html
                      • qgeomaneuver.html
                      • qgeoroute-members.html
                      • qgeoroute.html
                      • qgeoroutereply-members.html
                      • qgeoroutereply.html
                      • qgeorouterequest-members.html
                      • qgeorouterequest.html
                      • qgeoroutesegment-members.html
                      • qgeoroutesegment.html
                      • qgeoroutingmanager-members.html
                      • qgeoroutingmanager.html
                      • qgeoroutingmanagerengine-members.html
                      • qgeoroutingmanagerengine.html
                      • qgeoserviceprovider-members.html
                      • qgeoserviceprovider.html
                      • qgeoserviceproviderfactory-members.html
                      • qgeoserviceproviderfactory.html
                      • qlocation.html
                      • qml-location5-maps.html
                      • qml-qtlocation-category-members.html
                      • qml-qtlocation-category.html
                      • qml-qtlocation-categorymodel-members.html
                      • qml-qtlocation-categorymodel.html
                      • qml-qtlocation-contactdetail-members.html
                      • qml-qtlocation-contactdetail.html
                      • qml-qtlocation-contactdetails-members.html
                      • qml-qtlocation-contactdetails.html
                      • qml-qtlocation-editorialmodel-members.html
                      • qml-qtlocation-editorialmodel.html
                      • qml-qtlocation-extendedattributes-members.html
                      • qml-qtlocation-extendedattributes.html
                      • qml-qtlocation-geocodemodel-members.html
                      • qml-qtlocation-geocodemodel.html
                      • qml-qtlocation-icon-members.html
                      • qml-qtlocation-icon.html
                      • qml-qtlocation-imagemodel-members.html
                      • qml-qtlocation-imagemodel.html
                      • qml-qtlocation-map-members.html
                      • qml-qtlocation-map.html
                      • qml-qtlocation-mapcircle-members.html
                      • qml-qtlocation-mapcircle.html
                      • qml-qtlocation-mapgesturearea-members.html
                      • qml-qtlocation-mapgesturearea.html
                      • qml-qtlocation-mapitemview-members.html
                      • qml-qtlocation-mapitemview.html
                      • qml-qtlocation-mappinchevent-members.html
                      • qml-qtlocation-mappinchevent.html
                      • qml-qtlocation-mappolygon-members.html
                      • qml-qtlocation-mappolygon.html
                      • qml-qtlocation-mappolyline-members.html
                      • qml-qtlocation-mappolyline.html
                      • qml-qtlocation-mapquickitem-members.html
                      • qml-qtlocation-mapquickitem.html
                      • qml-qtlocation-maprectangle-members.html
                      • qml-qtlocation-maprectangle.html
                      • qml-qtlocation-maproute-members.html
                      • qml-qtlocation-maproute.html
                      • qml-qtlocation-maptype-members.html
                      • qml-qtlocation-maptype.html
                      • qml-qtlocation-place-members.html
                      • qml-qtlocation-place.html
                      • qml-qtlocation-placeattribute-members.html
                      • qml-qtlocation-placeattribute.html
                      • qml-qtlocation-placesearchmodel-members.html
                      • qml-qtlocation-placesearchmodel.html
                      • qml-qtlocation-placesearchsuggestionmodel-members.html
                      • qml-qtlocation-placesearchsuggestionmodel.html
                      • qml-qtlocation-plugin-members.html
                      • qml-qtlocation-plugin.html
                      • qml-qtlocation-pluginparameter-members.html
                      • qml-qtlocation-pluginparameter.html
                      • qml-qtlocation-ratings-members.html
                      • qml-qtlocation-ratings.html
                      • qml-qtlocation-reviewmodel-members.html
                      • qml-qtlocation-reviewmodel.html
                      • qml-qtlocation-route-members.html
                      • qml-qtlocation-route.html
                      • qml-qtlocation-routemaneuver-members.html
                      • qml-qtlocation-routemaneuver.html
                      • qml-qtlocation-routemodel-members.html
                      • qml-qtlocation-routemodel.html
                      • qml-qtlocation-routequery-members.html
                      • qml-qtlocation-routequery.html
                      • qml-qtlocation-routesegment-members.html
                      • qml-qtlocation-routesegment.html
                      • qml-qtlocation-supplier-members.html
                      • qml-qtlocation-supplier.html
                      • qml-qtlocation-user-members.html
                      • qml-qtlocation-user.html
                      • qml-qtlocation5-maps.html
                      • qplace-members.html
                      • qplace.html
                      • qplaceattribute-members.html
                      • qplaceattribute.html
                      • qplacecategory-members.html
                      • qplacecategory.html
                      • qplacecontactdetail-members.html
                      • qplacecontactdetail.html
                      • qplacecontent-members.html
                      • qplacecontent.html
                      • qplacecontentreply-members.html
                      • qplacecontentreply.html
                      • qplacecontentrequest-members.html
                      • qplacecontentrequest.html
                      • qplacedetailsreply-members.html
                      • qplacedetailsreply.html
                      • qplaceeditorial-members.html
                      • qplaceeditorial.html
                      • qplaceicon-members.html
                      • qplaceicon.html
                      • qplaceidreply-members.html
                      • qplaceidreply.html
                      • qplaceimage-members.html
                      • qplaceimage.html
                      • qplacemanager-members.html
                      • qplacemanager.html
                      • qplacemanagerengine-members.html
                      • qplacemanagerengine.html
                      • qplacematchreply-members.html
                      • qplacematchreply.html
                      • qplacematchrequest-members.html
                      • qplacematchrequest.html
                      • qplaceproposedsearchresult-members.html
                      • qplaceproposedsearchresult.html
                      • qplaceratings-members.html
                      • qplaceratings.html
                      • qplacereply-members.html
                      • qplacereply.html
                      • qplaceresult-members.html
                      • qplaceresult.html
                      • qplacereview-members.html
                      • qplacereview.html
                      • qplacesearchreply-members.html
                      • qplacesearchreply.html
                      • qplacesearchrequest-members.html
                      • qplacesearchrequest.html
                      • qplacesearchresult-members.html
                      • qplacesearchresult.html
                      • qplacesearchsuggestionreply-members.html
                      • qplacesearchsuggestionreply.html
                      • qplacesupplier-members.html
                      • qplacesupplier.html
                      • qplaceuser-members.html
                      • qplaceuser.html
                      • qtlocation-changes.html
                      • qtlocation-cpp.html
                      • qtlocation-examples.html
                      • qtlocation-geoservices.html
                      • qtlocation-index.html
                      • qtlocation-mapviewer-example.html
                      • qtlocation-mapviewer-forms-geocode-qml.html
                      • qtlocation-mapviewer-forms-geocodeform-ui-qml.html
                      • qtlocation-mapviewer-forms-locale-qml.html
                      • qtlocation-mapviewer-forms-localeform-ui-qml.html
                      • qtlocation-mapviewer-forms-message-qml.html
                      • qtlocation-mapviewer-forms-messageform-ui-qml.html
                      • qtlocation-mapviewer-forms-reversegeocode-qml.html
                      • qtlocation-mapviewer-forms-reversegeocodeform-ui-qml.html
                      • qtlocation-mapviewer-forms-routeaddress-qml.html
                      • qtlocation-mapviewer-forms-routeaddressform-ui-qml.html
                      • qtlocation-mapviewer-forms-routecoordinate-qml.html
                      • qtlocation-mapviewer-forms-routecoordinateform-ui-qml.html
                      • qtlocation-mapviewer-forms-routelist-qml.html
                      • qtlocation-mapviewer-forms-routelistdelegate-qml.html
                      • qtlocation-mapviewer-forms-routelistheader-qml.html
                      • qtlocation-mapviewer-helper-js.html
                      • qtlocation-mapviewer-main-cpp.html
                      • qtlocation-mapviewer-map-circleitem-qml.html
                      • qtlocation-mapviewer-map-imageitem-qml.html
                      • qtlocation-mapviewer-map-mapcomponent-qml.html
                      • qtlocation-mapviewer-map-marker-qml.html
                      • qtlocation-mapviewer-map-minimap-qml.html
                      • qtlocation-mapviewer-map-polygonitem-qml.html
                      • qtlocation-mapviewer-map-polylineitem-qml.html
                      • qtlocation-mapviewer-map-rectangleitem-qml.html
                      • qtlocation-mapviewer-mapviewer-pro.html
                      • qtlocation-mapviewer-mapviewer-qml.html
                      • qtlocation-mapviewer-mapviewer-qrc.html
                      • qtlocation-mapviewer-menus-itempopupmenu-qml.html
                      • qtlocation-mapviewer-menus-mainmenu-qml.html
                      • qtlocation-mapviewer-menus-mappopupmenu-qml.html
                      • qtlocation-mapviewer-menus-markerpopupmenu-qml.html
                      • qtlocation-minimal-map-example.html
                      • qtlocation-minimal-map-main-cpp.html
                      • qtlocation-minimal-map-main-qml.html
                      • qtlocation-minimal-map-minimal-map-pro.html
                      • qtlocation-minimal-map-qml-qrc.html
                      • qtlocation-module.html
                      • qtlocation-places-example.html
                      • qtlocation-places-forms-message-qml.html
                      • qtlocation-places-forms-messageform-ui-qml.html
                      • qtlocation-places-forms-placedetails-qml.html
                      • qtlocation-places-forms-placedetailsform-ui-qml.html
                      • qtlocation-places-forms-searchboundingbox-qml.html
                      • qtlocation-places-forms-searchboundingboxform-ui-qml.html
                      • qtlocation-places-forms-searchboundingcircle-qml.html
                      • qtlocation-places-forms-searchboundingcircleform-ui-qml.html
                      • qtlocation-places-forms-searchcenter-qml.html
                      • qtlocation-places-forms-searchcenterform-ui-qml.html
                      • qtlocation-places-forms-searchoptions-qml.html
                      • qtlocation-places-forms-searchoptionsform-ui-qml.html
                      • qtlocation-places-helper-js.html
                      • qtlocation-places-items-mainmenu-qml.html
                      • qtlocation-places-items-mapcomponent-qml.html
                      • qtlocation-places-items-searchbar-qml.html
                      • qtlocation-places-list-example.html
                      • qtlocation-places-list-main-cpp.html
                      • qtlocation-places-list-marker-qml.html
                      • qtlocation-places-list-places-list-pro.html
                      • qtlocation-places-list-places-list-qml.html
                      • qtlocation-places-list-places-list-qrc.html
                      • qtlocation-places-main-cpp.html
                      • qtlocation-places-map-example.html
                      • qtlocation-places-map-main-cpp.html
                      • qtlocation-places-map-places-map-pro.html
                      • qtlocation-places-map-places-map-qml.html
                      • qtlocation-places-map-places-map-qrc.html
                      • qtlocation-places-places-pro.html
                      • qtlocation-places-places-qml.html
                      • qtlocation-places-places-qrc.html
                      • qtlocation-places-views-categorydelegate-qml.html
                      • qtlocation-places-views-categoryview-qml.html
                      • qtlocation-places-views-editorialdelegate-qml.html
                      • qtlocation-places-views-editorialpage-qml.html
                      • qtlocation-places-views-editorialview-qml.html
                      • qtlocation-places-views-imageview-qml.html
                      • qtlocation-places-views-ratingview-qml.html
                      • qtlocation-places-views-reviewdelegate-qml.html
                      • qtlocation-places-views-reviewpage-qml.html
                      • qtlocation-places-views-reviewview-qml.html
                      • qtlocation-places-views-searchresultdelegate-qml.html
                      • qtlocation-places-views-searchresultview-qml.html
                      • qtlocation-places-views-suggestionview-qml.html
                      • qtlocation-planespotter-example.html
                      • qtlocation-planespotter-main-cpp.html
                      • qtlocation-planespotter-plane-qml.html
                      • qtlocation-planespotter-planespotter-pro.html
                      • qtlocation-planespotter-planespotter-qml.html
                      • qtlocation-planespotter-qml-qrc.html
                      • qtlocation-qmlmodule.html
                      • qtlocation.index
                      • qtlocation.qhp
                      • qtlocation.qhp.sha1
                      • qtlocation.tags
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtmacextras.qch
                    • qtmacextras
                      • examples-manifest.xml
                      • examples-qtmacextras.html
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                      • qmacpasteboardmime-members.html
                      • qmacpasteboardmime.html
                      • qmactoolbar-members.html
                      • qmactoolbar.html
                      • qmactoolbaritem-members.html
                      • qmactoolbaritem.html
                      • qtmac-obsolete.html
                      • qtmac.html
                      • qtmacextras-embeddedqwindow-embeddedqwindow-pro.html
                      • qtmacextras-embeddedqwindow-example.html
                      • qtmacextras-embeddedqwindow-window-cpp.html
                      • qtmacextras-embeddedqwindow-window-h.html
                      • qtmacextras-index.html
                      • qtmacextras-macfunctions-example.html
                      • qtmacextras-macfunctions-macfunctions-pro.html
                      • qtmacextras-macfunctions-macfunctions-qrc.html
                      • qtmacextras-macfunctions-main-cpp.html
                      • qtmacextras-macpasteboardmime-example.html
                      • qtmacextras-macpasteboardmime-macpasteboardmime-pro.html
                      • qtmacextras-macpasteboardmime-main-cpp.html
                      • qtmacextras-module.html
                      • qtmacextras.index
                      • qtmacextras.qhp
                      • qtmacextras.qhp.sha1
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtmultimedia.qch
                    • qtmultimedia
                      • audiooverview.html
                      • blackberry.html
                      • cameraoverview.html
                      • changes.html
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • audiodevices.png
                        • audioinput-example.png
                        • audiooutput-example.png
                        • audiorecorder.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • camera-example.png
                        • declarative-radio-example.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • mediaplayerex.jpg
                        • qml-camera.png
                        • qmlvideo-menu.jpg
                        • qmlvideo-overlay.jpg
                        • qmlvideofx-camera-glow.jpg
                        • qmlvideofx-camera-wobble.jpg
                        • qmlvideofx-effects-menu.jpg
                        • qmlvideofx-video-edgedetection.jpg
                        • qmlvideofx-video-pagecurl.jpg
                        • radio-example.png
                        • spectrum-demo.png
                        • used-in-examples
                          • multimedia
                            • declarative-camera
                              • images
                                • camera_auto_mode.png
                                • camera_camera_setting.png
                                • camera_flash_auto.png
                                • camera_flash_fill.png
                                • camera_flash_off.png
                                • camera_flash_redeye.png
                                • camera_white_balance_cloudy.png
                                • camera_white_balance_flourescent.png
                                • camera_white_balance_incandescent.png
                                • camera_white_balance_sunny.png
                                • toolbutton.png
                            • video
                              • qmlvideo
                                • images
                                  • folder.png
                                  • leaves.jpg
                                  • up.png
                              • qmlvideofx
                                • images
                                  • Dropdown_arrows.png
                                  • icon_BackArrow.png
                                  • icon_Folder.png
                                  • icon_Menu.png
                                  • qt-logo.png
                                  • Slider_bar.png
                                  • Slider_handle.png
                                  • Triangle_bottom.png
                                  • Triangle_Top.png
                        • video-qml-paint-rate.png
                        • video-videographicsitem.png
                        • video-videowidget.png
                      • multimedia-examples.html
                      • multimediabackend.html
                      • multimediaoverview.html
                      • qabstractplanarvideobuffer-members.html
                      • qabstractplanarvideobuffer.html
                      • qabstractvideobuffer-members.html
                      • qabstractvideobuffer.html
                      • qabstractvideofilter-members.html
                      • qabstractvideofilter.html
                      • qabstractvideosurface-members.html
                      • qabstractvideosurface.html
                      • qaudio.html
                      • qaudiobuffer-members.html
                      • qaudiobuffer-stereoframe-members.html
                      • qaudiobuffer-stereoframe.html
                      • qaudiobuffer.html
                      • qaudiodecoder-members.html
                      • qaudiodecoder.html
                      • qaudiodecodercontrol-members.html
                      • qaudiodecodercontrol.html
                      • qaudiodeviceinfo-members.html
                      • qaudiodeviceinfo.html
                      • qaudioencodersettings-members.html
                      • qaudioencodersettings.html
                      • qaudioencodersettingscontrol-members.html
                      • qaudioencodersettingscontrol.html
                      • qaudioformat-members.html
                      • qaudioformat.html
                      • qaudioinput-members.html
                      • qaudioinput.html
                      • qaudioinputselectorcontrol-members.html
                      • qaudioinputselectorcontrol.html
                      • qaudiooutput-members.html
                      • qaudiooutput.html
                      • qaudiooutputselectorcontrol-members.html
                      • qaudiooutputselectorcontrol.html
                      • qaudioprobe-members.html
                      • qaudioprobe.html
                      • qaudiorecorder-members.html
                      • qaudiorecorder.html
                      • qaudiorolecontrol-members.html
                      • qaudiorolecontrol.html
                      • qcamera-frameraterange-members.html
                      • qcamera-frameraterange.html
                      • qcamera-members.html
                      • qcamera-obsolete.html
                      • qcamera.html
                      • qcameracapturebufferformatcontrol-members.html
                      • qcameracapturebufferformatcontrol.html
                      • qcameracapturedestinationcontrol-members.html
                      • qcameracapturedestinationcontrol.html
                      • qcameracontrol-members.html
                      • qcameracontrol.html
                      • qcameraexposure-members.html
                      • qcameraexposure.html
                      • qcameraexposurecontrol-members.html
                      • qcameraexposurecontrol.html
                      • qcamerafeedbackcontrol-members.html
                      • qcamerafeedbackcontrol.html
                      • qcameraflashcontrol-members.html
                      • qcameraflashcontrol.html
                      • qcamerafocus-members.html
                      • qcamerafocus.html
                      • qcamerafocuscontrol-members.html
                      • qcamerafocuscontrol.html
                      • qcamerafocuszone-members.html
                      • qcamerafocuszone.html
                      • qcameraimagecapture-members.html
                      • qcameraimagecapture.html
                      • qcameraimagecapturecontrol-members.html
                      • qcameraimagecapturecontrol.html
                      • qcameraimageprocessing-members.html
                      • qcameraimageprocessing.html
                      • qcameraimageprocessingcontrol-members.html
                      • qcameraimageprocessingcontrol.html
                      • qcamerainfo-members.html
                      • qcamerainfo.html
                      • qcamerainfocontrol-members.html
                      • qcamerainfocontrol.html
                      • qcameralockscontrol-members.html
                      • qcameralockscontrol.html
                      • qcameraviewfinder-members.html
                      • qcameraviewfinder.html
                      • qcameraviewfindersettings-members.html
                      • qcameraviewfindersettings.html
                      • qcameraviewfindersettingscontrol-members.html
                      • qcameraviewfindersettingscontrol.html
                      • qcameraviewfindersettingscontrol2-members.html
                      • qcameraviewfindersettingscontrol2.html
                      • qcamerazoomcontrol-members.html
                      • qcamerazoomcontrol.html
                      • qgraphicsvideoitem-members.html
                      • qgraphicsvideoitem.html
                      • qimageencodercontrol-members.html
                      • qimageencodercontrol.html
                      • qimageencodersettings-members.html
                      • qimageencodersettings.html
                      • qmediaaudioprobecontrol-members.html
                      • qmediaaudioprobecontrol.html
                      • qmediaavailabilitycontrol-members.html
                      • qmediaavailabilitycontrol.html
                      • qmediabindableinterface-members.html
                      • qmediabindableinterface.html
                      • qmediacontainercontrol-members.html
                      • qmediacontainercontrol.html
                      • qmediacontent-members.html
                      • qmediacontent.html
                      • qmediacontrol-members.html
                      • qmediacontrol.html
                      • qmediagaplessplaybackcontrol-members.html
                      • qmediagaplessplaybackcontrol.html
                      • qmediametadata.html
                      • qmedianetworkaccesscontrol-members.html
                      • qmedianetworkaccesscontrol.html
                      • qmediaobject-members.html
                      • qmediaobject.html
                      • qmediaplayer-members.html
                      • qmediaplayer-obsolete.html
                      • qmediaplayer.html
                      • qmediaplayercontrol-members.html
                      • qmediaplayercontrol.html
                      • qmediaplaylist-members.html
                      • qmediaplaylist.html
                      • qmediarecorder-members.html
                      • qmediarecorder.html
                      • qmediarecordercontrol-members.html
                      • qmediarecordercontrol.html
                      • qmediaresource-members.html
                      • qmediaresource.html
                      • qmediaservice-members.html
                      • qmediaservice.html
                      • qmediaservicecamerainfointerface-members.html
                      • qmediaservicecamerainfointerface.html
                      • qmediaservicedefaultdeviceinterface-members.html
                      • qmediaservicedefaultdeviceinterface.html
                      • qmediaservicefeaturesinterface-members.html
                      • qmediaservicefeaturesinterface.html
                      • qmediaserviceproviderplugin-members.html
                      • qmediaserviceproviderplugin.html
                      • qmediaservicesupporteddevicesinterface-members.html
                      • qmediaservicesupporteddevicesinterface.html
                      • qmediaservicesupportedformatsinterface-members.html
                      • qmediaservicesupportedformatsinterface.html
                      • qmediastreamscontrol-members.html
                      • qmediastreamscontrol.html
                      • qmediatimeinterval-members.html
                      • qmediatimeinterval.html
                      • qmediatimerange-members.html
                      • qmediatimerange.html
                      • qmediavideoprobecontrol-members.html
                      • qmediavideoprobecontrol.html
                      • qmetadatareadercontrol-members.html
                      • qmetadatareadercontrol.html
                      • qmetadatawritercontrol-members.html
                      • qmetadatawritercontrol.html
                      • qml-multimedia.html
                      • qml-qtaudioengine-attenuationmodelinverse-members.html
                      • qml-qtaudioengine-attenuationmodelinverse.html
                      • qml-qtaudioengine-attenuationmodellinear-members.html
                      • qml-qtaudioengine-attenuationmodellinear.html
                      • qml-qtaudioengine-audiocategory-members.html
                      • qml-qtaudioengine-audiocategory.html
                      • qml-qtaudioengine-audioengine-members.html
                      • qml-qtaudioengine-audioengine.html
                      • qml-qtaudioengine-audiolistener-members.html
                      • qml-qtaudioengine-audiolistener.html
                      • qml-qtaudioengine-audiosample-members.html
                      • qml-qtaudioengine-audiosample.html
                      • qml-qtaudioengine-playvariation-members.html
                      • qml-qtaudioengine-playvariation.html
                      • qml-qtaudioengine-sound-members.html
                      • qml-qtaudioengine-sound.html
                      • qml-qtaudioengine-soundinstance-members.html
                      • qml-qtaudioengine-soundinstance.html
                      • qml-qtmultimedia-audio-members.html
                      • qml-qtmultimedia-audio.html
                      • qml-qtmultimedia-camera-members.html
                      • qml-qtmultimedia-camera.html
                      • qml-qtmultimedia-cameracapture-members.html
                      • qml-qtmultimedia-cameracapture.html
                      • qml-qtmultimedia-cameraexposure-members.html
                      • qml-qtmultimedia-cameraexposure.html
                      • qml-qtmultimedia-cameraflash-members.html
                      • qml-qtmultimedia-cameraflash.html
                      • qml-qtmultimedia-camerafocus-members.html
                      • qml-qtmultimedia-camerafocus.html
                      • qml-qtmultimedia-cameraimageprocessing-members.html
                      • qml-qtmultimedia-cameraimageprocessing.html
                      • qml-qtmultimedia-camerarecorder-members.html
                      • qml-qtmultimedia-camerarecorder.html
                      • qml-qtmultimedia-mediaplayer-members.html
                      • qml-qtmultimedia-mediaplayer.html
                      • qml-qtmultimedia-playlist-members.html
                      • qml-qtmultimedia-playlist.html
                      • qml-qtmultimedia-playlistitem-members.html
                      • qml-qtmultimedia-playlistitem.html
                      • qml-qtmultimedia-qtmultimedia-members.html
                      • qml-qtmultimedia-qtmultimedia.html
                      • qml-qtmultimedia-radio-members.html
                      • qml-qtmultimedia-radio.html
                      • qml-qtmultimedia-radiodata-members.html
                      • qml-qtmultimedia-radiodata.html
                      • qml-qtmultimedia-soundeffect-members.html
                      • qml-qtmultimedia-soundeffect.html
                      • qml-qtmultimedia-torch-members.html
                      • qml-qtmultimedia-torch.html
                      • qml-qtmultimedia-video-members.html
                      • qml-qtmultimedia-video.html
                      • qml-qtmultimedia-videooutput-members.html
                      • qml-qtmultimedia-videooutput.html
                      • qmultimedia.html
                      • qradiodata-members.html
                      • qradiodata.html
                      • qradiodatacontrol-members.html
                      • qradiodatacontrol.html
                      • qradiotuner-members.html
                      • qradiotuner.html
                      • qradiotunercontrol-members.html
                      • qradiotunercontrol.html
                      • qsound-members.html
                      • qsound.html
                      • qsoundeffect-members.html
                      • qsoundeffect.html
                      • qtaudioengine-qmlmodule.html
                      • qtmultimedia-index.html
                      • qtmultimedia-module.html
                      • qtmultimedia-modules.html
                      • qtmultimedia-multimedia-audiodevices-audiodevices-cpp.html
                      • qtmultimedia-multimedia-audiodevices-audiodevices-h.html
                      • qtmultimedia-multimedia-audiodevices-audiodevices-pro.html
                      • qtmultimedia-multimedia-audiodevices-audiodevicesbase-ui.html
                      • qtmultimedia-multimedia-audiodevices-example.html
                      • qtmultimedia-multimedia-audiodevices-main-cpp.html
                      • qtmultimedia-multimedia-audioengine-audioengine-pro.html
                      • qtmultimedia-multimedia-audioengine-example.html
                      • qtmultimedia-multimedia-audioengine-qml-audioengine-qml.html
                      • qtmultimedia-multimedia-audioengine-qml-audioengine-qmlproject.html
                      • qtmultimedia-multimedia-audioengine-qml-content-myaudioengine-qml.html
                      • qtmultimedia-multimedia-audioinput-audioinput-cpp.html
                      • qtmultimedia-multimedia-audioinput-audioinput-h.html
                      • qtmultimedia-multimedia-audioinput-audioinput-pro.html
                      • qtmultimedia-multimedia-audioinput-example.html
                      • qtmultimedia-multimedia-audioinput-main-cpp.html
                      • qtmultimedia-multimedia-audiooutput-audiooutput-cpp.html
                      • qtmultimedia-multimedia-audiooutput-audiooutput-h.html
                      • qtmultimedia-multimedia-audiooutput-audiooutput-pro.html
                      • qtmultimedia-multimedia-audiooutput-example.html
                      • qtmultimedia-multimedia-audiooutput-main-cpp.html
                      • qtmultimedia-multimedia-audiorecorder-audiorecorder-cpp.html
                      • qtmultimedia-multimedia-audiorecorder-audiorecorder-h.html
                      • qtmultimedia-multimedia-audiorecorder-audiorecorder-pro.html
                      • qtmultimedia-multimedia-audiorecorder-audiorecorder-ui.html
                      • qtmultimedia-multimedia-audiorecorder-example.html
                      • qtmultimedia-multimedia-audiorecorder-main-cpp.html
                      • qtmultimedia-multimedia-audiorecorder-qaudiolevel-cpp.html
                      • qtmultimedia-multimedia-audiorecorder-qaudiolevel-h.html
                      • qtmultimedia-multimedia-declarative-camera-camerabutton-qml.html
                      • qtmultimedia-multimedia-declarative-camera-cameralistbutton-qml.html
                      • qtmultimedia-multimedia-declarative-camera-cameralistpopup-qml.html
                      • qtmultimedia-multimedia-declarative-camera-camerapropertybutton-qml.html
                      • qtmultimedia-multimedia-declarative-camera-camerapropertypopup-qml.html
                      • qtmultimedia-multimedia-declarative-camera-declarative-camera-pro.html
                      • qtmultimedia-multimedia-declarative-camera-declarative-camera-qml.html
                      • qtmultimedia-multimedia-declarative-camera-declarative-camera-qmlproject.html
                      • qtmultimedia-multimedia-declarative-camera-declarative-camera-qrc.html
                      • qtmultimedia-multimedia-declarative-camera-example.html
                      • qtmultimedia-multimedia-declarative-camera-focusbutton-qml.html
                      • qtmultimedia-multimedia-declarative-camera-photocapturecontrols-qml.html
                      • qtmultimedia-multimedia-declarative-camera-photopreview-qml.html
                      • qtmultimedia-multimedia-declarative-camera-popup-qml.html
                      • qtmultimedia-multimedia-declarative-camera-qmlcamera-cpp.html
                      • qtmultimedia-multimedia-declarative-camera-videocapturecontrols-qml.html
                      • qtmultimedia-multimedia-declarative-camera-videopreview-qml.html
                      • qtmultimedia-multimedia-declarative-camera-zoomcontrol-qml.html
                      • qtmultimedia-multimedia-declarative-radio-declarative-radio-pro.html
                      • qtmultimedia-multimedia-declarative-radio-declarative-radio-qrc.html
                      • qtmultimedia-multimedia-declarative-radio-example.html
                      • qtmultimedia-multimedia-declarative-radio-main-cpp.html
                      • qtmultimedia-multimedia-declarative-radio-view-qml.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-array-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-def-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-dynarray-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-pro.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-wrapper-cpp.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-wrapper-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealfixlen-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealfixlenparam-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealpassdirect-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealpassinverse-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealselect-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealusetrigo-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-oscsincos-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-clockcyclecounter-cpp.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-clockcyclecounter-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-def-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-fnc-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-int64-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-stopwatch-cpp.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-stopwatch-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-test-cpp.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-test-fnc-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-test-settings-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testaccuracy-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testhelperfixlen-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testhelpernormal-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testspeed-h.html
                      • qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testwhitenoisegen-h.html
                      • qtmultimedia-multimedia-spectrum-app-app-pro.html
                      • qtmultimedia-multimedia-spectrum-app-engine-cpp.html
                      • qtmultimedia-multimedia-spectrum-app-engine-h.html
                      • qtmultimedia-multimedia-spectrum-app-frequencyspectrum-cpp.html
                      • qtmultimedia-multimedia-spectrum-app-frequencyspectrum-h.html
                      • qtmultimedia-multimedia-spectrum-app-levelmeter-cpp.html
                      • qtmultimedia-multimedia-spectrum-app-levelmeter-h.html
                      • qtmultimedia-multimedia-spectrum-app-main-cpp.html
                      • qtmultimedia-multimedia-spectrum-app-mainwidget-cpp.html
                      • qtmultimedia-multimedia-spectrum-app-mainwidget-h.html
                      • qtmultimedia-multimedia-spectrum-app-progressbar-cpp.html
                      • qtmultimedia-multimedia-spectrum-app-progressbar-h.html
                      • qtmultimedia-multimedia-spectrum-app-settingsdialog-cpp.html
                      • qtmultimedia-multimedia-spectrum-app-settingsdialog-h.html
                      • qtmultimedia-multimedia-spectrum-app-spectrograph-cpp.html
                      • qtmultimedia-multimedia-spectrum-app-spectrograph-h.html
                      • qtmultimedia-multimedia-spectrum-app-spectrum-h.html
                      • qtmultimedia-multimedia-spectrum-app-spectrum-qrc.html
                      • qtmultimedia-multimedia-spectrum-app-spectrumanalyser-cpp.html
                      • qtmultimedia-multimedia-spectrum-app-spectrumanalyser-h.html
                      • qtmultimedia-multimedia-spectrum-app-tonegenerator-cpp.html
                      • qtmultimedia-multimedia-spectrum-app-tonegenerator-h.html
                      • qtmultimedia-multimedia-spectrum-app-tonegeneratordialog-cpp.html
                      • qtmultimedia-multimedia-spectrum-app-tonegeneratordialog-h.html
                      • qtmultimedia-multimedia-spectrum-app-utils-cpp.html
                      • qtmultimedia-multimedia-spectrum-app-utils-h.html
                      • qtmultimedia-multimedia-spectrum-app-waveform-cpp.html
                      • qtmultimedia-multimedia-spectrum-app-waveform-h.html
                      • qtmultimedia-multimedia-spectrum-app-wavfile-cpp.html
                      • qtmultimedia-multimedia-spectrum-app-wavfile-h.html
                      • qtmultimedia-multimedia-spectrum-example.html
                      • qtmultimedia-multimedia-spectrum-spectrum-pro.html
                      • qtmultimedia-multimedia-video-qmlvideo-example.html
                      • qtmultimedia-multimedia-video-qmlvideo-main-cpp.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-button-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerabasic-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameradrag-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameradummy-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerafullscreen-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerafullscreeninverted-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraitem-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameramove-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraoverlay-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraresize-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerarotate-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraspin-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-content-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-errordialog-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-filebrowser-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-main-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scene-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenebasic-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenedrag-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenefullscreen-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenefullscreeninverted-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenemove-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenemulti-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-sceneoverlay-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-sceneresize-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenerotate-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-sceneselectionpanel-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenespin-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-seekcontrol-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videobasic-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videodrag-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videodummy-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videofillmode-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videofullscreen-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videofullscreeninverted-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoitem-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videometadata-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videomove-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videooverlay-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoplaybackrate-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoresize-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videorotate-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoseek-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videospin-qml.html
                      • qtmultimedia-multimedia-video-qmlvideo-qmlvideo-pro.html
                      • qtmultimedia-multimedia-video-qmlvideo-qmlvideo-qrc.html
                      • qtmultimedia-multimedia-video-qmlvideo-qmlvideo-svg.html
                      • qtmultimedia-multimedia-video-qmlvideo-trace-h.html
                      • qtmultimedia-multimedia-video-qmlvideofx-example.html
                      • qtmultimedia-multimedia-video-qmlvideofx-filereader-cpp.html
                      • qtmultimedia-multimedia-video-qmlvideofx-filereader-h.html
                      • qtmultimedia-multimedia-video-qmlvideofx-main-cpp.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-button-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-content-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-contentcamera-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-contentimage-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-contentvideo-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-curtain-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-divider-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effect-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectbillboard-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectblackandwhite-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectemboss-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectgaussianblur-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectglow-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectisolate-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectmagnify-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectpagecurl-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectpassthrough-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectpixelate-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectposterize-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectripple-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectselectionlist-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectsepia-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectsharpen-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectshockwave-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectsobeledgedetection1-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effecttiltshift-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effecttoon-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectvignette-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectwarhol-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectwobble-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-filebrowser-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-fileopen-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-hintedmousearea-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-main-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-parameterpanel-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-slider-qml.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qmlapplicationviewer-qmlapplicationviewer-cpp.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qmlapplicationviewer-qmlapplicationviewer-h.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qmlvideofx-pro.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qmlvideofx-qrc.html
                      • qtmultimedia-multimedia-video-qmlvideofx-qmlvideofx-svg.html
                      • qtmultimedia-multimedia-video-qmlvideofx-trace-h.html
                      • qtmultimedia-multimediawidgets-camera-camera-cpp.html
                      • qtmultimedia-multimediawidgets-camera-camera-h.html
                      • qtmultimedia-multimediawidgets-camera-camera-pro.html
                      • qtmultimedia-multimediawidgets-camera-camera-ui.html
                      • qtmultimedia-multimediawidgets-camera-example.html
                      • qtmultimedia-multimediawidgets-camera-imagesettings-cpp.html
                      • qtmultimedia-multimediawidgets-camera-imagesettings-h.html
                      • qtmultimedia-multimediawidgets-camera-imagesettings-ui.html
                      • qtmultimedia-multimediawidgets-camera-main-cpp.html
                      • qtmultimedia-multimediawidgets-camera-videosettings-cpp.html
                      • qtmultimedia-multimediawidgets-camera-videosettings-h.html
                      • qtmultimedia-multimediawidgets-camera-videosettings-ui.html
                      • qtmultimedia-multimediawidgets-player-example.html
                      • qtmultimedia-multimediawidgets-player-histogramwidget-cpp.html
                      • qtmultimedia-multimediawidgets-player-histogramwidget-h.html
                      • qtmultimedia-multimediawidgets-player-main-cpp.html
                      • qtmultimedia-multimediawidgets-player-player-cpp.html
                      • qtmultimedia-multimediawidgets-player-player-h.html
                      • qtmultimedia-multimediawidgets-player-player-pro.html
                      • qtmultimedia-multimediawidgets-player-playercontrols-cpp.html
                      • qtmultimedia-multimediawidgets-player-playercontrols-h.html
                      • qtmultimedia-multimediawidgets-player-playlistmodel-cpp.html
                      • qtmultimedia-multimediawidgets-player-playlistmodel-h.html
                      • qtmultimedia-multimediawidgets-player-videowidget-cpp.html
                      • qtmultimedia-multimediawidgets-player-videowidget-h.html
                      • qtmultimedia-multimediawidgets-videographicsitem-example.html
                      • qtmultimedia-multimediawidgets-videographicsitem-main-cpp.html
                      • qtmultimedia-multimediawidgets-videographicsitem-videographicsitem-pro.html
                      • qtmultimedia-multimediawidgets-videographicsitem-videoplayer-cpp.html
                      • qtmultimedia-multimediawidgets-videographicsitem-videoplayer-h.html
                      • qtmultimedia-multimediawidgets-videowidget-example.html
                      • qtmultimedia-multimediawidgets-videowidget-main-cpp.html
                      • qtmultimedia-multimediawidgets-videowidget-videoplayer-cpp.html
                      • qtmultimedia-multimediawidgets-videowidget-videoplayer-h.html
                      • qtmultimedia-multimediawidgets-videowidget-videowidget-pro.html
                      • qtmultimedia-qmlmodule.html
                      • qtmultimedia-windows.html
                      • qtmultimedia.index
                      • qtmultimedia.qhp
                      • qtmultimedia.qhp.sha1
                      • qtmultimediawidgets-index.html
                      • qtmultimediawidgets-module.html
                      • qvideodeviceselectorcontrol-members.html
                      • qvideodeviceselectorcontrol.html
                      • qvideoencodersettings-members.html
                      • qvideoencodersettings.html
                      • qvideoencodersettingscontrol-members.html
                      • qvideoencodersettingscontrol.html
                      • qvideofilterrunnable-members.html
                      • qvideofilterrunnable.html
                      • qvideoframe-members.html
                      • qvideoframe.html
                      • qvideoprobe-members.html
                      • qvideoprobe.html
                      • qvideorenderercontrol-members.html
                      • qvideorenderercontrol.html
                      • qvideosurfaceformat-members.html
                      • qvideosurfaceformat.html
                      • qvideowidget-members.html
                      • qvideowidget.html
                      • qvideowidgetcontrol-members.html
                      • qvideowidgetcontrol.html
                      • qvideowindowcontrol-members.html
                      • qvideowindowcontrol.html
                      • radiooverview.html
                      • style
                        • offline-simple.css
                        • offline.css
                      • videooverview.html
                    • qtnetwork.qch
                    • qtnetwork
                      • bearer-management.html
                      • examples-manifest.xml
                      • examples-network.html
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • blockingfortuneclient-example.png
                        • broadcastreceiver-example.png
                        • broadcastsender-example.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • fortuneclient-example.png
                        • fortuneserver-example.png
                        • googlesuggest-example.png
                        • home.png
                        • http-example.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • loopback-example.png
                        • multicastreceiver-example.png
                        • multicastsender-example.png
                        • network-chat-example.png
                        • network-examples.png
                        • roaming-states.png
                        • securesocketclient.png
                        • securesocketclient2.png
                        • tcpstream.png
                        • threadedfortuneserver-example.png
                        • torrent-example.png
                        • udppackets.png
                      • network.html
                      • qabstractnetworkcache-members.html
                      • qabstractnetworkcache.html
                      • qabstractsocket-members.html
                      • qabstractsocket.html
                      • qauthenticator-members.html
                      • qauthenticator.html
                      • qdnsdomainnamerecord-members.html
                      • qdnsdomainnamerecord.html
                      • qdnshostaddressrecord-members.html
                      • qdnshostaddressrecord.html
                      • qdnslookup-members.html
                      • qdnslookup.html
                      • qdnsmailexchangerecord-members.html
                      • qdnsmailexchangerecord.html
                      • qdnsservicerecord-members.html
                      • qdnsservicerecord.html
                      • qdnstextrecord-members.html
                      • qdnstextrecord.html
                      • qhostaddress-members.html
                      • qhostaddress.html
                      • qhostinfo-members.html
                      • qhostinfo.html
                      • qhttpmultipart-members.html
                      • qhttpmultipart.html
                      • qhttppart-members.html
                      • qhttppart.html
                      • qlocalserver-members.html
                      • qlocalserver.html
                      • qlocalsocket-members.html
                      • qlocalsocket.html
                      • qnetworkaccessmanager-members.html
                      • qnetworkaccessmanager.html
                      • qnetworkaddressentry-members.html
                      • qnetworkaddressentry.html
                      • qnetworkcachemetadata-members.html
                      • qnetworkcachemetadata.html
                      • qnetworkconfiguration-members.html
                      • qnetworkconfiguration.html
                      • qnetworkconfigurationmanager-members.html
                      • qnetworkconfigurationmanager.html
                      • qnetworkcookie-members.html
                      • qnetworkcookie.html
                      • qnetworkcookiejar-members.html
                      • qnetworkcookiejar.html
                      • qnetworkdiskcache-members.html
                      • qnetworkdiskcache.html
                      • qnetworkinterface-members.html
                      • qnetworkinterface.html
                      • qnetworkproxy-members.html
                      • qnetworkproxy.html
                      • qnetworkproxyfactory-members.html
                      • qnetworkproxyfactory.html
                      • qnetworkproxyquery-members.html
                      • qnetworkproxyquery.html
                      • qnetworkreply-members.html
                      • qnetworkreply.html
                      • qnetworkrequest-members.html
                      • qnetworkrequest.html
                      • qnetworksession-members.html
                      • qnetworksession.html
                      • qssl-obsolete.html
                      • qssl.html
                      • qsslcertificate-members.html
                      • qsslcertificate-obsolete.html
                      • qsslcertificate.html
                      • qsslcertificateextension-members.html
                      • qsslcertificateextension.html
                      • qsslcipher-members.html
                      • qsslcipher.html
                      • qsslconfiguration-members.html
                      • qsslconfiguration.html
                      • qsslellipticcurve-members.html
                      • qsslellipticcurve.html
                      • qsslerror-members.html
                      • qsslerror.html
                      • qsslkey-members.html
                      • qsslkey.html
                      • qsslpresharedkeyauthenticator-members.html
                      • qsslpresharedkeyauthenticator.html
                      • qsslsocket-members.html
                      • qsslsocket-obsolete.html
                      • qsslsocket.html
                      • qtcpserver-members.html
                      • qtcpserver.html
                      • qtcpsocket-members.html
                      • qtcpsocket.html
                      • qtnetwork-blockingfortuneclient-blockingclient-cpp.html
                      • qtnetwork-blockingfortuneclient-blockingclient-h.html
                      • qtnetwork-blockingfortuneclient-blockingfortuneclient-pro.html
                      • qtnetwork-blockingfortuneclient-example.html
                      • qtnetwork-blockingfortuneclient-fortunethread-cpp.html
                      • qtnetwork-blockingfortuneclient-fortunethread-h.html
                      • qtnetwork-blockingfortuneclient-main-cpp.html
                      • qtnetwork-broadcastreceiver-broadcastreceiver-pro.html
                      • qtnetwork-broadcastreceiver-example.html
                      • qtnetwork-broadcastreceiver-main-cpp.html
                      • qtnetwork-broadcastreceiver-receiver-cpp.html
                      • qtnetwork-broadcastreceiver-receiver-h.html
                      • qtnetwork-broadcastsender-broadcastsender-pro.html
                      • qtnetwork-broadcastsender-example.html
                      • qtnetwork-broadcastsender-main-cpp.html
                      • qtnetwork-broadcastsender-sender-cpp.html
                      • qtnetwork-broadcastsender-sender-h.html
                      • qtnetwork-download-download-pro.html
                      • qtnetwork-download-example.html
                      • qtnetwork-download-main-cpp.html
                      • qtnetwork-downloadmanager-downloadmanager-cpp.html
                      • qtnetwork-downloadmanager-downloadmanager-h.html
                      • qtnetwork-downloadmanager-downloadmanager-pro.html
                      • qtnetwork-downloadmanager-example.html
                      • qtnetwork-downloadmanager-main-cpp.html
                      • qtnetwork-downloadmanager-textprogressbar-cpp.html
                      • qtnetwork-downloadmanager-textprogressbar-h.html
                      • qtnetwork-fortuneclient-client-cpp.html
                      • qtnetwork-fortuneclient-client-h.html
                      • qtnetwork-fortuneclient-example.html
                      • qtnetwork-fortuneclient-fortuneclient-pro.html
                      • qtnetwork-fortuneclient-main-cpp.html
                      • qtnetwork-fortuneserver-example.html
                      • qtnetwork-fortuneserver-fortuneserver-pro.html
                      • qtnetwork-fortuneserver-main-cpp.html
                      • qtnetwork-fortuneserver-server-cpp.html
                      • qtnetwork-fortuneserver-server-h.html
                      • qtnetwork-googlesuggest-example.html
                      • qtnetwork-googlesuggest-googlesuggest-cpp.html
                      • qtnetwork-googlesuggest-googlesuggest-h.html
                      • qtnetwork-googlesuggest-googlesuggest-pro.html
                      • qtnetwork-googlesuggest-main-cpp.html
                      • qtnetwork-googlesuggest-searchbox-cpp.html
                      • qtnetwork-googlesuggest-searchbox-h.html
                      • qtnetwork-http-authenticationdialog-ui.html
                      • qtnetwork-http-example.html
                      • qtnetwork-http-http-pro.html
                      • qtnetwork-http-httpwindow-cpp.html
                      • qtnetwork-http-httpwindow-h.html
                      • qtnetwork-http-main-cpp.html
                      • qtnetwork-index.html
                      • qtnetwork-loopback-dialog-cpp.html
                      • qtnetwork-loopback-dialog-h.html
                      • qtnetwork-loopback-example.html
                      • qtnetwork-loopback-loopback-pro.html
                      • qtnetwork-loopback-main-cpp.html
                      • qtnetwork-module.html
                      • qtnetwork-multicastreceiver-example.html
                      • qtnetwork-multicastreceiver-main-cpp.html
                      • qtnetwork-multicastreceiver-multicastreceiver-pro.html
                      • qtnetwork-multicastreceiver-receiver-cpp.html
                      • qtnetwork-multicastreceiver-receiver-h.html
                      • qtnetwork-multicastsender-example.html
                      • qtnetwork-multicastsender-main-cpp.html
                      • qtnetwork-multicastsender-multicastsender-pro.html
                      • qtnetwork-multicastsender-sender-cpp.html
                      • qtnetwork-multicastsender-sender-h.html
                      • qtnetwork-network-chat-chatdialog-cpp.html
                      • qtnetwork-network-chat-chatdialog-h.html
                      • qtnetwork-network-chat-chatdialog-ui.html
                      • qtnetwork-network-chat-client-cpp.html
                      • qtnetwork-network-chat-client-h.html
                      • qtnetwork-network-chat-connection-cpp.html
                      • qtnetwork-network-chat-connection-h.html
                      • qtnetwork-network-chat-example.html
                      • qtnetwork-network-chat-main-cpp.html
                      • qtnetwork-network-chat-network-chat-pro.html
                      • qtnetwork-network-chat-peermanager-cpp.html
                      • qtnetwork-network-chat-peermanager-h.html
                      • qtnetwork-network-chat-server-cpp.html
                      • qtnetwork-network-chat-server-h.html
                      • qtnetwork-programming.html
                      • qtnetwork-securesocketclient-certificateinfo-cpp.html
                      • qtnetwork-securesocketclient-certificateinfo-h.html
                      • qtnetwork-securesocketclient-certificateinfo-ui.html
                      • qtnetwork-securesocketclient-example.html
                      • qtnetwork-securesocketclient-main-cpp.html
                      • qtnetwork-securesocketclient-securesocketclient-pro.html
                      • qtnetwork-securesocketclient-securesocketclient-qrc.html
                      • qtnetwork-securesocketclient-sslclient-cpp.html
                      • qtnetwork-securesocketclient-sslclient-h.html
                      • qtnetwork-securesocketclient-sslclient-ui.html
                      • qtnetwork-securesocketclient-sslerrors-ui.html
                      • qtnetwork-threadedfortuneserver-dialog-cpp.html
                      • qtnetwork-threadedfortuneserver-dialog-h.html
                      • qtnetwork-threadedfortuneserver-example.html
                      • qtnetwork-threadedfortuneserver-fortuneserver-cpp.html
                      • qtnetwork-threadedfortuneserver-fortuneserver-h.html
                      • qtnetwork-threadedfortuneserver-fortunethread-cpp.html
                      • qtnetwork-threadedfortuneserver-fortunethread-h.html
                      • qtnetwork-threadedfortuneserver-main-cpp.html
                      • qtnetwork-threadedfortuneserver-threadedfortuneserver-pro.html
                      • qtnetwork-torrent-addtorrentdialog-cpp.html
                      • qtnetwork-torrent-addtorrentdialog-h.html
                      • qtnetwork-torrent-bencodeparser-cpp.html
                      • qtnetwork-torrent-bencodeparser-h.html
                      • qtnetwork-torrent-connectionmanager-cpp.html
                      • qtnetwork-torrent-connectionmanager-h.html
                      • qtnetwork-torrent-example.html
                      • qtnetwork-torrent-filemanager-cpp.html
                      • qtnetwork-torrent-filemanager-h.html
                      • qtnetwork-torrent-forms-addtorrentform-ui.html
                      • qtnetwork-torrent-icons-qrc.html
                      • qtnetwork-torrent-main-cpp.html
                      • qtnetwork-torrent-mainwindow-cpp.html
                      • qtnetwork-torrent-mainwindow-h.html
                      • qtnetwork-torrent-metainfo-cpp.html
                      • qtnetwork-torrent-metainfo-h.html
                      • qtnetwork-torrent-peerwireclient-cpp.html
                      • qtnetwork-torrent-peerwireclient-h.html
                      • qtnetwork-torrent-ratecontroller-cpp.html
                      • qtnetwork-torrent-ratecontroller-h.html
                      • qtnetwork-torrent-torrent-pro.html
                      • qtnetwork-torrent-torrentclient-cpp.html
                      • qtnetwork-torrent-torrentclient-h.html
                      • qtnetwork-torrent-torrentserver-cpp.html
                      • qtnetwork-torrent-torrentserver-h.html
                      • qtnetwork-torrent-trackerclient-cpp.html
                      • qtnetwork-torrent-trackerclient-h.html
                      • qtnetwork.index
                      • qtnetwork.qhp
                      • qtnetwork.qhp.sha1
                      • qtnetwork.tags
                      • qudpsocket-members.html
                      • qudpsocket.html
                      • ssl.html
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtnfc.qch
                    • qtnfc
                      • examples-manifest.xml
                      • images
                        • annotatedurl.png
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • corkboard.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • ndefeditor.png
                        • qml-poster-example.png
                      • nfc-android.html
                      • nfc-examples.html
                      • qml-qtnfc-ndeffilter-members.html
                      • qml-qtnfc-ndeffilter.html
                      • qml-qtnfc-ndefmimerecord-members.html
                      • qml-qtnfc-ndefmimerecord.html
                      • qml-qtnfc-ndefrecord-members.html
                      • qml-qtnfc-ndefrecord.html
                      • qml-qtnfc-ndeftextrecord-members.html
                      • qml-qtnfc-ndeftextrecord.html
                      • qml-qtnfc-ndefurirecord-members.html
                      • qml-qtnfc-ndefurirecord.html
                      • qml-qtnfc-nearfield-members.html
                      • qml-qtnfc-nearfield.html
                      • qndeffilter-members.html
                      • qndeffilter-record-members.html
                      • qndeffilter-record.html
                      • qndeffilter.html
                      • qndefmessage-members.html
                      • qndefmessage.html
                      • qndefnfcsmartposterrecord-members.html
                      • qndefnfcsmartposterrecord.html
                      • qndefnfctextrecord-members.html
                      • qndefnfctextrecord.html
                      • qndefnfcurirecord-members.html
                      • qndefnfcurirecord.html
                      • qndefrecord-members.html
                      • qndefrecord.html
                      • qnearfieldmanager-members.html
                      • qnearfieldmanager.html
                      • qnearfieldsharemanager-members.html
                      • qnearfieldsharemanager.html
                      • qnearfieldsharetarget-members.html
                      • qnearfieldsharetarget.html
                      • qnearfieldtarget-members.html
                      • qnearfieldtarget-requestid-members.html
                      • qnearfieldtarget-requestid.html
                      • qnearfieldtarget-requestidprivate.html
                      • qnearfieldtarget.html
                      • qqmlndefrecord-members.html
                      • qqmlndefrecord.html
                      • qtnfc-annotatedurl-annotatedurl-cpp.html
                      • qtnfc-annotatedurl-annotatedurl-h.html
                      • qtnfc-annotatedurl-annotatedurl-pro.html
                      • qtnfc-annotatedurl-example.html
                      • qtnfc-annotatedurl-main-cpp.html
                      • qtnfc-annotatedurl-mainwindow-cpp.html
                      • qtnfc-annotatedurl-mainwindow-h.html
                      • qtnfc-annotatedurl-mainwindow-ui.html
                      • qtnfc-corkboard-android-androidmanifest-xml.html
                      • qtnfc-corkboard-corkboard-pro.html
                      • qtnfc-corkboard-corkboard-qrc.html
                      • qtnfc-corkboard-corkboards-qml.html
                      • qtnfc-corkboard-example.html
                      • qtnfc-corkboard-main-cpp.html
                      • qtnfc-corkboard-mode-qml.html
                      • qtnfc-index.html
                      • qtnfc-module.html
                      • qtnfc-ndefeditor-example.html
                      • qtnfc-ndefeditor-main-cpp.html
                      • qtnfc-ndefeditor-mainwindow-cpp.html
                      • qtnfc-ndefeditor-mainwindow-h.html
                      • qtnfc-ndefeditor-mainwindow-ui.html
                      • qtnfc-ndefeditor-mimeimagerecordeditor-cpp.html
                      • qtnfc-ndefeditor-mimeimagerecordeditor-h.html
                      • qtnfc-ndefeditor-mimeimagerecordeditor-ui.html
                      • qtnfc-ndefeditor-ndefeditor-pro.html
                      • qtnfc-ndefeditor-textrecordeditor-cpp.html
                      • qtnfc-ndefeditor-textrecordeditor-h.html
                      • qtnfc-ndefeditor-textrecordeditor-ui.html
                      • qtnfc-ndefeditor-urirecordeditor-cpp.html
                      • qtnfc-ndefeditor-urirecordeditor-h.html
                      • qtnfc-ndefeditor-urirecordeditor-ui.html
                      • qtnfc-overview.html
                      • qtnfc-poster-example.html
                      • qtnfc-poster-poster-pro.html
                      • qtnfc-poster-poster-qml.html
                      • qtnfc-poster-poster-qrc.html
                      • qtnfc-poster-qmlposter-cpp.html
                      • qtnfc-qmlmodule.html
                      • qtnfc.index
                      • qtnfc.qhp
                      • qtnfc.qhp.sha1
                      • qtnfc.tags
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtopengl.qch
                    • qtopengl
                      • examples-manifest.xml
                      • examples-widgets-opengl.html
                      • images
                        • 2dpainting-example.png
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • cube.png
                        • cube_faces.png
                        • hellogl2-example.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • opengl-examples.png
                        • textures-example.png
                        • used-in-examples
                          • textures
                            • images
                              • side1.png
                              • side2.png
                              • side3.png
                              • side4.png
                              • side5.png
                              • side6.png
                      • qgl.html
                      • qglbuffer-members.html
                      • qglbuffer.html
                      • qglcolormap-members.html
                      • qglcolormap.html
                      • qglcontext-members.html
                      • qglcontext-obsolete.html
                      • qglcontext.html
                      • qglformat-members.html
                      • qglformat.html
                      • qglframebufferobject-members.html
                      • qglframebufferobject.html
                      • qglframebufferobjectformat-members.html
                      • qglframebufferobjectformat.html
                      • qglfunctions-members.html
                      • qglfunctions.html
                      • qglpixelbuffer-members.html
                      • qglpixelbuffer.html
                      • qglshader-members.html
                      • qglshader.html
                      • qglshaderprogram-members.html
                      • qglshaderprogram.html
                      • qglwidget-members.html
                      • qglwidget-obsolete.html
                      • qglwidget.html
                      • qtopengl-2dpainting-2dpainting-pro.html
                      • qtopengl-2dpainting-example.html
                      • qtopengl-2dpainting-glwidget-cpp.html
                      • qtopengl-2dpainting-glwidget-h.html
                      • qtopengl-2dpainting-helper-cpp.html
                      • qtopengl-2dpainting-helper-h.html
                      • qtopengl-2dpainting-main-cpp.html
                      • qtopengl-2dpainting-widget-cpp.html
                      • qtopengl-2dpainting-widget-h.html
                      • qtopengl-2dpainting-window-cpp.html
                      • qtopengl-2dpainting-window-h.html
                      • qtopengl-cube-cube-pro.html
                      • qtopengl-cube-example.html
                      • qtopengl-cube-fshader-glsl.html
                      • qtopengl-cube-geometryengine-cpp.html
                      • qtopengl-cube-geometryengine-h.html
                      • qtopengl-cube-main-cpp.html
                      • qtopengl-cube-mainwidget-cpp.html
                      • qtopengl-cube-mainwidget-h.html
                      • qtopengl-cube-shaders-qrc.html
                      • qtopengl-cube-textures-qrc.html
                      • qtopengl-cube-vshader-glsl.html
                      • qtopengl-hellogl2-example.html
                      • qtopengl-hellogl2-glwidget-cpp.html
                      • qtopengl-hellogl2-glwidget-h.html
                      • qtopengl-hellogl2-hellogl2-pro.html
                      • qtopengl-hellogl2-logo-cpp.html
                      • qtopengl-hellogl2-logo-h.html
                      • qtopengl-hellogl2-main-cpp.html
                      • qtopengl-hellogl2-mainwindow-cpp.html
                      • qtopengl-hellogl2-mainwindow-h.html
                      • qtopengl-hellogl2-window-cpp.html
                      • qtopengl-hellogl2-window-h.html
                      • qtopengl-index.html
                      • qtopengl-module.html
                      • qtopengl-textures-example.html
                      • qtopengl-textures-glwidget-cpp.html
                      • qtopengl-textures-glwidget-h.html
                      • qtopengl-textures-main-cpp.html
                      • qtopengl-textures-textures-pro.html
                      • qtopengl-textures-textures-qrc.html
                      • qtopengl-textures-window-cpp.html
                      • qtopengl-textures-window-h.html
                      • qtopengl.index
                      • qtopengl.qhp
                      • qtopengl.qhp.sha1
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtplatformheaders.qch
                    • qtplatformheaders
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                      • qcocoanativecontext-members.html
                      • qcocoanativecontext.html
                      • qcocoawindowfunctions-members.html
                      • qcocoawindowfunctions.html
                      • qeglfsfunctions-members.html
                      • qeglfsfunctions.html
                      • qeglnativecontext-members.html
                      • qeglnativecontext.html
                      • qglxnativecontext-members.html
                      • qglxnativecontext.html
                      • qtplatformheaders-index.html
                      • qtplatformheaders-module.html
                      • qtplatformheaders.index
                      • qtplatformheaders.qhp
                      • qtplatformheaders.qhp.sha1
                      • qwglnativecontext-members.html
                      • qwglnativecontext.html
                      • qwindowswindowfunctions-members.html
                      • qwindowswindowfunctions.html
                      • qxcbwindowfunctions-members.html
                      • qxcbwindowfunctions.html
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtpositioning.qch
                    • qtpositioning
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • example-satelliteinfo.png
                        • example-weatherinfo.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • qml-flickr-1.jpg
                      • location-positioning-cpp.html
                      • location-positioning-qml.html
                      • positioning-cpp-qml.html
                      • qgeoaddress-members.html
                      • qgeoaddress.html
                      • qgeoareamonitorinfo-members.html
                      • qgeoareamonitorinfo.html
                      • qgeoareamonitorsource-members.html
                      • qgeoareamonitorsource.html
                      • qgeocircle-members.html
                      • qgeocircle.html
                      • qgeocoordinate-members.html
                      • qgeocoordinate.html
                      • qgeolocation-members.html
                      • qgeolocation.html
                      • qgeopositioninfo-members.html
                      • qgeopositioninfo.html
                      • qgeopositioninfosource-members.html
                      • qgeopositioninfosource.html
                      • qgeopositioninfosourcefactory-members.html
                      • qgeopositioninfosourcefactory.html
                      • qgeorectangle-members.html
                      • qgeorectangle.html
                      • qgeosatelliteinfo-members.html
                      • qgeosatelliteinfo.html
                      • qgeosatelliteinfosource-members.html
                      • qgeosatelliteinfosource.html
                      • qgeoshape-members.html
                      • qgeoshape.html
                      • qml-coordinate.html
                      • qml-geocircle.html
                      • qml-georectangle.html
                      • qml-geoshape.html
                      • qml-qtpositioning-address-members.html
                      • qml-qtpositioning-address.html
                      • qml-qtpositioning-coordinateanimation-members.html
                      • qml-qtpositioning-coordinateanimation.html
                      • qml-qtpositioning-location-members.html
                      • qml-qtpositioning-location.html
                      • qml-qtpositioning-position-members.html
                      • qml-qtpositioning-position.html
                      • qml-qtpositioning-positionsource-members.html
                      • qml-qtpositioning-positionsource.html
                      • qml-qtpositioning-qtpositioning-members.html
                      • qml-qtpositioning-qtpositioning.html
                      • qnmeapositioninfosource-members.html
                      • qnmeapositioninfosource.html
                      • qtpositioning-examples.html
                      • qtpositioning-geoflickr-example.html
                      • qtpositioning-geoflickr-flickr-90-qml.html
                      • qtpositioning-geoflickr-flickr-qml.html
                      • qtpositioning-geoflickr-flickr-qrc.html
                      • qtpositioning-geoflickr-flickrcommon-progress-qml.html
                      • qtpositioning-geoflickr-flickrcommon-restmodel-qml.html
                      • qtpositioning-geoflickr-flickrcommon-scrollbar-qml.html
                      • qtpositioning-geoflickr-flickrcommon-slider-qml.html
                      • qtpositioning-geoflickr-flickrmobile-button-qml.html
                      • qtpositioning-geoflickr-flickrmobile-geotab-qml.html
                      • qtpositioning-geoflickr-flickrmobile-griddelegate-qml.html
                      • qtpositioning-geoflickr-flickrmobile-imagedetails-qml.html
                      • qtpositioning-geoflickr-flickrmobile-listdelegate-qml.html
                      • qtpositioning-geoflickr-flickrmobile-titlebar-qml.html
                      • qtpositioning-geoflickr-flickrmobile-toolbar-qml.html
                      • qtpositioning-geoflickr-geoflickr-pro.html
                      • qtpositioning-geoflickr-geoflickr-qmlproject.html
                      • qtpositioning-geoflickr-qmllocationflickr-cpp.html
                      • qtpositioning-index.html
                      • qtpositioning-logfilepositionsource-clientapplication-cpp.html
                      • qtpositioning-logfilepositionsource-clientapplication-h.html
                      • qtpositioning-logfilepositionsource-example.html
                      • qtpositioning-logfilepositionsource-logfile-qrc.html
                      • qtpositioning-logfilepositionsource-logfilepositionsource-cpp.html
                      • qtpositioning-logfilepositionsource-logfilepositionsource-h.html
                      • qtpositioning-logfilepositionsource-logfilepositionsource-pro.html
                      • qtpositioning-logfilepositionsource-main-cpp.html
                      • qtpositioning-module.html
                      • qtpositioning-plugins.html
                      • qtpositioning-qmlmodule.html
                      • qtpositioning-satelliteinfo-example.html
                      • qtpositioning-satelliteinfo-main-cpp.html
                      • qtpositioning-satelliteinfo-satelliteinfo-pro.html
                      • qtpositioning-satelliteinfo-satelliteinfo-qml.html
                      • qtpositioning-satelliteinfo-satelliteinfo-qrc.html
                      • qtpositioning-satelliteinfo-satellitemodel-cpp.html
                      • qtpositioning-satelliteinfo-satellitemodel-h.html
                      • qtpositioning-weatherinfo-appmodel-cpp.html
                      • qtpositioning-weatherinfo-appmodel-h.html
                      • qtpositioning-weatherinfo-components-bigforecasticon-qml.html
                      • qtpositioning-weatherinfo-components-forecasticon-qml.html
                      • qtpositioning-weatherinfo-components-weathericon-qml.html
                      • qtpositioning-weatherinfo-example.html
                      • qtpositioning-weatherinfo-main-cpp.html
                      • qtpositioning-weatherinfo-weatherinfo-pro.html
                      • qtpositioning-weatherinfo-weatherinfo-qml.html
                      • qtpositioning-weatherinfo-weatherinfo-qrc.html
                      • qtpositioning.index
                      • qtpositioning.qhp
                      • qtpositioning.qhp.sha1
                      • qtpositioning.tags
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtprintsupport.qch
                    • qtprintsupport
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • plastique-printdialog-properties.png
                        • plastique-printdialog.png
                        • printer-rects.png
                      • pdf-licensing.html
                      • printing.html
                      • qabstractprintdialog-members.html
                      • qabstractprintdialog-obsolete.html
                      • qabstractprintdialog.html
                      • qpagesetupdialog-members.html
                      • qpagesetupdialog.html
                      • qprintdialog-members.html
                      • qprintdialog.html
                      • qprintengine-members.html
                      • qprintengine.html
                      • qprinter-members.html
                      • qprinter-obsolete.html
                      • qprinter.html
                      • qprinterinfo-members.html
                      • qprinterinfo-obsolete.html
                      • qprinterinfo.html
                      • qprintpreviewdialog-members.html
                      • qprintpreviewdialog.html
                      • qprintpreviewwidget-members.html
                      • qprintpreviewwidget.html
                      • qtprintsupport-index.html
                      • qtprintsupport-module.html
                      • qtprintsupport.index
                      • qtprintsupport.qhp
                      • qtprintsupport.qhp.sha1
                      • qtprintsupport.tags
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtpurchasing.qch
                    • qtpurchasing
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • qthangman-example.png
                        • qthangman-store-example.png
                      • qinappproduct-members.html
                      • qinappproduct.html
                      • qinappstore-members.html
                      • qinappstore.html
                      • qinapptransaction-members.html
                      • qinapptransaction.html
                      • qml-qtpurchasing-product-members.html
                      • qml-qtpurchasing-product.html
                      • qml-qtpurchasing-store-members.html
                      • qml-qtpurchasing-store.html
                      • qml-qtpurchasing-transaction-members.html
                      • qml-qtpurchasing-transaction.html
                      • qtpurchasing-appstore.html
                      • qtpurchasing-examples.html
                      • qtpurchasing-gettingstarted-cpp.html
                      • qtpurchasing-gettingstarted-qml.html
                      • qtpurchasing-googleplay.html
                      • qtpurchasing-index.html
                      • qtpurchasing-module.html
                      • qtpurchasing-qmlmodule.html
                      • qtpurchasing-qthangman-example.html
                      • qtpurchasing-qthangman-hangmangame-cpp.html
                      • qtpurchasing-qthangman-hangmangame-h.html
                      • qtpurchasing-qthangman-main-cpp.html
                      • qtpurchasing-qthangman-qml-qthangman-gameview-qml.html
                      • qtpurchasing-qthangman-qml-qthangman-guesswordview-qml.html
                      • qtpurchasing-qthangman-qml-qthangman-hangman-qml.html
                      • qtpurchasing-qthangman-qml-qthangman-howtoview-qml.html
                      • qtpurchasing-qthangman-qml-qthangman-key-qml.html
                      • qtpurchasing-qthangman-qml-qthangman-letter-qml.html
                      • qtpurchasing-qthangman-qml-qthangman-letterselector-qml.html
                      • qtpurchasing-qthangman-qml-qthangman-main-qml.html
                      • qtpurchasing-qthangman-qml-qthangman-mainview-qml.html
                      • qtpurchasing-qthangman-qml-qthangman-pageheader-qml.html
                      • qtpurchasing-qthangman-qml-qthangman-scoreitem-qml.html
                      • qtpurchasing-qthangman-qml-qthangman-simplebutton-qml.html
                      • qtpurchasing-qthangman-qml-qthangman-splashscreen-qml.html
                      • qtpurchasing-qthangman-qml-qthangman-storeitem-qml.html
                      • qtpurchasing-qthangman-qml-qthangman-storeview-qml.html
                      • qtpurchasing-qthangman-qml-qthangman-word-qml.html
                      • qtpurchasing-qthangman-qthangman-pro.html
                      • qtpurchasing-qthangman-resources-qrc.html
                      • qtpurchasing.index
                      • qtpurchasing.qhp
                      • qtpurchasing.qhp.sha1
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtqml.qch
                    • qtqml
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • button-types.png
                        • declarative-rect_tint.png
                        • documents-definetypes-attributes.png
                        • documents-definetypes-simple.png
                        • extending-tutorial-chapter1.png
                        • extending-tutorial-chapter2.png
                        • extending-tutorial-chapter3.png
                        • extending-tutorial-chapter5.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • listmodel-nested.png
                        • listmodel.png
                        • logo.png
                        • qml-dynamicscene-example.png
                        • qml-i18n-example.png
                        • qml-plugins-example.png
                        • qml-xmlhttprequest-example.png
                        • qtqml-syntax-basics-object-declaration.png
                        • statemachine-button-history.png
                        • statemachine-button-nested.png
                        • statemachine-button.png
                        • statemachine-finished.png
                        • statemachine-nonparallel.png
                        • statemachine-parallel.png
                        • visualitemmodel.png
                      • qjsengine-members.html
                      • qjsengine-obsolete.html
                      • qjsengine.html
                      • qjsvalue-members.html
                      • qjsvalue-obsolete.html
                      • qjsvalue.html
                      • qjsvalueiterator-members.html
                      • qjsvalueiterator.html
                      • qml-bool.html
                      • qml-date.html
                      • qml-double.html
                      • qml-enumeration.html
                      • qml-int.html
                      • qml-list.html
                      • qml-package-members.html
                      • qml-package.html
                      • qml-point.html
                      • qml-qtqml-binding-members.html
                      • qml-qtqml-binding.html
                      • qml-qtqml-component-members.html
                      • qml-qtqml-component.html
                      • qml-qtqml-connections-members.html
                      • qml-qtqml-connections.html
                      • qml-qtqml-date-members.html
                      • qml-qtqml-date.html
                      • qml-qtqml-instantiator-members.html
                      • qml-qtqml-instantiator.html
                      • qml-qtqml-locale-members.html
                      • qml-qtqml-locale.html
                      • qml-qtqml-models-delegatemodel-members.html
                      • qml-qtqml-models-delegatemodel.html
                      • qml-qtqml-models-delegatemodelgroup-members.html
                      • qml-qtqml-models-delegatemodelgroup.html
                      • qml-qtqml-models-itemselectionmodel-members.html
                      • qml-qtqml-models-itemselectionmodel.html
                      • qml-qtqml-models-listelement-members.html
                      • qml-qtqml-models-listelement.html
                      • qml-qtqml-models-listmodel-members.html
                      • qml-qtqml-models-listmodel.html
                      • qml-qtqml-models-objectmodel-members.html
                      • qml-qtqml-models-objectmodel.html
                      • qml-qtqml-number-members.html
                      • qml-qtqml-number.html
                      • qml-qtqml-qt-members.html
                      • qml-qtqml-qt.html
                      • qml-qtqml-qtobject-members.html
                      • qml-qtqml-qtobject.html
                      • qml-qtqml-statemachine-finalstate-members.html
                      • qml-qtqml-statemachine-finalstate.html
                      • qml-qtqml-statemachine-historystate-members.html
                      • qml-qtqml-statemachine-historystate.html
                      • qml-qtqml-statemachine-qabstractstate-members.html
                      • qml-qtqml-statemachine-qabstractstate.html
                      • qml-qtqml-statemachine-qabstracttransition-members.html
                      • qml-qtqml-statemachine-qabstracttransition.html
                      • qml-qtqml-statemachine-qsignaltransition-members.html
                      • qml-qtqml-statemachine-qsignaltransition.html
                      • qml-qtqml-statemachine-signaltransition-members.html
                      • qml-qtqml-statemachine-signaltransition.html
                      • qml-qtqml-statemachine-state-members.html
                      • qml-qtqml-statemachine-state.html
                      • qml-qtqml-statemachine-statemachine-members.html
                      • qml-qtqml-statemachine-statemachine.html
                      • qml-qtqml-statemachine-timeouttransition-members.html
                      • qml-qtqml-statemachine-timeouttransition.html
                      • qml-qtqml-string-members.html
                      • qml-qtqml-string.html
                      • qml-qtqml-timer-members.html
                      • qml-qtqml-timer.html
                      • qml-real.html
                      • qml-rect.html
                      • qml-size.html
                      • qml-string.html
                      • qml-url.html
                      • qml-var.html
                      • qml-variant.html
                      • qml-visualdatagroup-members.html
                      • qml-visualdatagroup.html
                      • qml-visualdatamodel-members.html
                      • qml-visualdatamodel.html
                      • qml-visualitemmodel-members.html
                      • qml-visualitemmodel.html
                      • qml-workerscript-members.html
                      • qml-workerscript.html
                      • qmlextendingexamples.html
                      • qmlreference.html
                      • qmlstatemachine.html
                      • qmodelindex-and-related-classes-in-qml.html
                      • qqmlabstracturlinterceptor-members.html
                      • qqmlabstracturlinterceptor.html
                      • qqmlapplicationengine-members.html
                      • qqmlapplicationengine.html
                      • qqmlcomponent-members.html
                      • qqmlcomponent.html
                      • qqmlcontext-members.html
                      • qqmlcontext.html
                      • qqmlengine-members.html
                      • qqmlengine.html
                      • qqmlerror-members.html
                      • qqmlerror.html
                      • qqmlexpression-members.html
                      • qqmlexpression.html
                      • qqmlextensionplugin-members.html
                      • qqmlextensionplugin.html
                      • qqmlfileselector-members.html
                      • qqmlfileselector.html
                      • qqmlimageproviderbase-members.html
                      • qqmlimageproviderbase.html
                      • qqmlincubationcontroller-members.html
                      • qqmlincubationcontroller.html
                      • qqmlincubator-members.html
                      • qqmlincubator.html
                      • qqmllistproperty-members.html
                      • qqmllistproperty.html
                      • qqmllistreference-members.html
                      • qqmllistreference.html
                      • qqmlnetworkaccessmanagerfactory-members.html
                      • qqmlnetworkaccessmanagerfactory.html
                      • qqmlparserstatus-members.html
                      • qqmlparserstatus.html
                      • qqmlproperty-members.html
                      • qqmlproperty.html
                      • qqmlpropertymap-members.html
                      • qqmlpropertymap.html
                      • qqmlpropertyvaluesource-members.html
                      • qqmlpropertyvaluesource.html
                      • qqmlscriptstring-members.html
                      • qqmlscriptstring.html
                      • qtjavascript.html
                      • qtqml-cppclasses-topic.html
                      • qtqml-cppintegration-contextproperties.html
                      • qtqml-cppintegration-data.html
                      • qtqml-cppintegration-definetypes.html
                      • qtqml-cppintegration-exposecppattributes.html
                      • qtqml-cppintegration-interactqmlfromcpp.html
                      • qtqml-cppintegration-topic.html
                      • qtqml-documents-definetypes.html
                      • qtqml-documents-networktransparency.html
                      • qtqml-documents-scope.html
                      • qtqml-documents-structure.html
                      • qtqml-documents-topic.html
                      • qtqml-dynamicscene-content-button-qml.html
                      • qtqml-dynamicscene-content-genericsceneitem-qml.html
                      • qtqml-dynamicscene-content-itemcreation-js.html
                      • qtqml-dynamicscene-content-paletteitem-qml.html
                      • qtqml-dynamicscene-content-perspectiveitem-qml.html
                      • qtqml-dynamicscene-content-sun-qml.html
                      • qtqml-dynamicscene-dynamicscene-qml.html
                      • qtqml-dynamicscene-dynamicscene-qmlproject.html
                      • qtqml-dynamicscene-example.html
                      • qtqml-index.html
                      • qtqml-javascript-dynamicobjectcreation.html
                      • qtqml-javascript-expressions.html
                      • qtqml-javascript-functionlist.html
                      • qtqml-javascript-hostenvironment.html
                      • qtqml-javascript-imports.html
                      • qtqml-javascript-qmlglobalobject.html
                      • qtqml-javascript-resources.html
                      • qtqml-javascript-topic.html
                      • qtqml-models-qmlmodule.html
                      • qtqml-module.html
                      • qtqml-modules-cppplugins.html
                      • qtqml-modules-identifiedmodules.html
                      • qtqml-modules-legacymodules.html
                      • qtqml-modules-qmldir.html
                      • qtqml-modules-topic.html
                      • qtqml-networkaccessmanagerfactory-example.html
                      • qtqml-networkaccessmanagerfactory-main-cpp.html
                      • qtqml-networkaccessmanagerfactory-networkaccessmanagerfactory-pro.html
                      • qtqml-networkaccessmanagerfactory-networkaccessmanagerfactory-qmlproject.html
                      • qtqml-networkaccessmanagerfactory-networkaccessmanagerfactory-qrc.html
                      • qtqml-networkaccessmanagerfactory-view-qml.html
                      • qtqml-qml-i18n-example.html
                      • qtqml-qml-i18n-qml-i18n-qml.html
                      • qtqml-qml-i18n-qml-i18n-qmlproject.html
                      • qtqml-qmlextensionplugins-example.html
                      • qtqml-qmlextensionplugins-imports-timeexample-clock-qml.html
                      • qtqml-qmlextensionplugins-imports-timeexample-qmldir.html
                      • qtqml-qmlextensionplugins-plugin-cpp.html
                      • qtqml-qmlextensionplugins-plugins-qml.html
                      • qtqml-qmlextensionplugins-plugins-qmlproject.html
                      • qtqml-qmlextensionplugins-qmlextensionplugins-pro.html
                      • qtqml-qmlmodule.html
                      • qtqml-referenceexamples-adding-adding-pro.html
                      • qtqml-referenceexamples-adding-adding-qrc.html
                      • qtqml-referenceexamples-adding-example-qml.html
                      • qtqml-referenceexamples-adding-example.html
                      • qtqml-referenceexamples-adding-main-cpp.html
                      • qtqml-referenceexamples-adding-person-cpp.html
                      • qtqml-referenceexamples-adding-person-h.html
                      • qtqml-referenceexamples-attached-attached-pro.html
                      • qtqml-referenceexamples-attached-attached-qrc.html
                      • qtqml-referenceexamples-attached-birthdayparty-cpp.html
                      • qtqml-referenceexamples-attached-birthdayparty-h.html
                      • qtqml-referenceexamples-attached-example-qml.html
                      • qtqml-referenceexamples-attached-example.html
                      • qtqml-referenceexamples-attached-main-cpp.html
                      • qtqml-referenceexamples-attached-person-cpp.html
                      • qtqml-referenceexamples-attached-person-h.html
                      • qtqml-referenceexamples-binding-binding-pro.html
                      • qtqml-referenceexamples-binding-binding-qrc.html
                      • qtqml-referenceexamples-binding-birthdayparty-cpp.html
                      • qtqml-referenceexamples-binding-birthdayparty-h.html
                      • qtqml-referenceexamples-binding-example-qml.html
                      • qtqml-referenceexamples-binding-example.html
                      • qtqml-referenceexamples-binding-happybirthdaysong-cpp.html
                      • qtqml-referenceexamples-binding-happybirthdaysong-h.html
                      • qtqml-referenceexamples-binding-main-cpp.html
                      • qtqml-referenceexamples-binding-person-cpp.html
                      • qtqml-referenceexamples-binding-person-h.html
                      • qtqml-referenceexamples-coercion-birthdayparty-cpp.html
                      • qtqml-referenceexamples-coercion-birthdayparty-h.html
                      • qtqml-referenceexamples-coercion-coercion-pro.html
                      • qtqml-referenceexamples-coercion-coercion-qrc.html
                      • qtqml-referenceexamples-coercion-example-qml.html
                      • qtqml-referenceexamples-coercion-example.html
                      • qtqml-referenceexamples-coercion-main-cpp.html
                      • qtqml-referenceexamples-coercion-person-cpp.html
                      • qtqml-referenceexamples-coercion-person-h.html
                      • qtqml-referenceexamples-default-birthdayparty-cpp.html
                      • qtqml-referenceexamples-default-birthdayparty-h.html
                      • qtqml-referenceexamples-default-default-pro.html
                      • qtqml-referenceexamples-default-default-qrc.html
                      • qtqml-referenceexamples-default-example-qml.html
                      • qtqml-referenceexamples-default-example.html
                      • qtqml-referenceexamples-default-main-cpp.html
                      • qtqml-referenceexamples-default-person-cpp.html
                      • qtqml-referenceexamples-default-person-h.html
                      • qtqml-referenceexamples-extended-example-qml.html
                      • qtqml-referenceexamples-extended-example.html
                      • qtqml-referenceexamples-extended-extended-pro.html
                      • qtqml-referenceexamples-extended-extended-qrc.html
                      • qtqml-referenceexamples-extended-lineedit-cpp.html
                      • qtqml-referenceexamples-extended-lineedit-h.html
                      • qtqml-referenceexamples-extended-main-cpp.html
                      • qtqml-referenceexamples-grouped-birthdayparty-cpp.html
                      • qtqml-referenceexamples-grouped-birthdayparty-h.html
                      • qtqml-referenceexamples-grouped-example-qml.html
                      • qtqml-referenceexamples-grouped-example.html
                      • qtqml-referenceexamples-grouped-grouped-pro.html
                      • qtqml-referenceexamples-grouped-grouped-qrc.html
                      • qtqml-referenceexamples-grouped-main-cpp.html
                      • qtqml-referenceexamples-grouped-person-cpp.html
                      • qtqml-referenceexamples-grouped-person-h.html
                      • qtqml-referenceexamples-methods-birthdayparty-cpp.html
                      • qtqml-referenceexamples-methods-birthdayparty-h.html
                      • qtqml-referenceexamples-methods-example-qml.html
                      • qtqml-referenceexamples-methods-example.html
                      • qtqml-referenceexamples-methods-main-cpp.html
                      • qtqml-referenceexamples-methods-methods-pro.html
                      • qtqml-referenceexamples-methods-methods-qrc.html
                      • qtqml-referenceexamples-methods-person-cpp.html
                      • qtqml-referenceexamples-methods-person-h.html
                      • qtqml-referenceexamples-properties-birthdayparty-cpp.html
                      • qtqml-referenceexamples-properties-birthdayparty-h.html
                      • qtqml-referenceexamples-properties-example-qml.html
                      • qtqml-referenceexamples-properties-example.html
                      • qtqml-referenceexamples-properties-main-cpp.html
                      • qtqml-referenceexamples-properties-person-cpp.html
                      • qtqml-referenceexamples-properties-person-h.html
                      • qtqml-referenceexamples-properties-properties-pro.html
                      • qtqml-referenceexamples-properties-properties-qrc.html
                      • qtqml-referenceexamples-signal-birthdayparty-cpp.html
                      • qtqml-referenceexamples-signal-birthdayparty-h.html
                      • qtqml-referenceexamples-signal-example-qml.html
                      • qtqml-referenceexamples-signal-example.html
                      • qtqml-referenceexamples-signal-main-cpp.html
                      • qtqml-referenceexamples-signal-person-cpp.html
                      • qtqml-referenceexamples-signal-person-h.html
                      • qtqml-referenceexamples-signal-signal-pro.html
                      • qtqml-referenceexamples-signal-signal-qrc.html
                      • qtqml-referenceexamples-valuesource-birthdayparty-cpp.html
                      • qtqml-referenceexamples-valuesource-birthdayparty-h.html
                      • qtqml-referenceexamples-valuesource-example-qml.html
                      • qtqml-referenceexamples-valuesource-example.html
                      • qtqml-referenceexamples-valuesource-happybirthdaysong-cpp.html
                      • qtqml-referenceexamples-valuesource-happybirthdaysong-h.html
                      • qtqml-referenceexamples-valuesource-main-cpp.html
                      • qtqml-referenceexamples-valuesource-person-cpp.html
                      • qtqml-referenceexamples-valuesource-person-h.html
                      • qtqml-referenceexamples-valuesource-valuesource-pro.html
                      • qtqml-referenceexamples-valuesource-valuesource-qrc.html
                      • qtqml-statemachine-qmlmodule.html
                      • qtqml-syntax-basics.html
                      • qtqml-syntax-directoryimports.html
                      • qtqml-syntax-imports.html
                      • qtqml-syntax-objectattributes.html
                      • qtqml-syntax-propertybinding.html
                      • qtqml-syntax-signals.html
                      • qtqml-tutorials-extending-qml-chapter1-basics-app-qml.html
                      • qtqml-tutorials-extending-qml-chapter1-basics-chapter1-basics-pro.html
                      • qtqml-tutorials-extending-qml-chapter1-basics-chapter1-basics-qrc.html
                      • qtqml-tutorials-extending-qml-chapter1-basics-main-cpp.html
                      • qtqml-tutorials-extending-qml-chapter1-basics-piechart-cpp.html
                      • qtqml-tutorials-extending-qml-chapter1-basics-piechart-h.html
                      • qtqml-tutorials-extending-qml-chapter2-methods-app-qml.html
                      • qtqml-tutorials-extending-qml-chapter2-methods-chapter2-methods-pro.html
                      • qtqml-tutorials-extending-qml-chapter2-methods-chapter2-methods-qrc.html
                      • qtqml-tutorials-extending-qml-chapter2-methods-piechart-cpp.html
                      • qtqml-tutorials-extending-qml-chapter2-methods-piechart-h.html
                      • qtqml-tutorials-extending-qml-chapter3-bindings-app-qml.html
                      • qtqml-tutorials-extending-qml-chapter3-bindings-chapter3-bindings-pro.html
                      • qtqml-tutorials-extending-qml-chapter3-bindings-chapter3-bindings-qrc.html
                      • qtqml-tutorials-extending-qml-chapter3-bindings-piechart-cpp.html
                      • qtqml-tutorials-extending-qml-chapter3-bindings-piechart-h.html
                      • qtqml-tutorials-extending-qml-chapter4-custompropertytypes-app-qml.html
                      • qtqml-tutorials-extending-qml-chapter4-custompropertytypes-chapter4-custompropertytypes-pro.html
                      • qtqml-tutorials-extending-qml-chapter4-custompropertytypes-chapter4-custompropertytypes-qrc.html
                      • qtqml-tutorials-extending-qml-chapter4-custompropertytypes-piechart-cpp.html
                      • qtqml-tutorials-extending-qml-chapter4-custompropertytypes-piechart-h.html
                      • qtqml-tutorials-extending-qml-chapter4-custompropertytypes-pieslice-cpp.html
                      • qtqml-tutorials-extending-qml-chapter4-custompropertytypes-pieslice-h.html
                      • qtqml-tutorials-extending-qml-chapter5-listproperties-app-qml.html
                      • qtqml-tutorials-extending-qml-chapter5-listproperties-chapter5-listproperties-pro.html
                      • qtqml-tutorials-extending-qml-chapter5-listproperties-chapter5-listproperties-qrc.html
                      • qtqml-tutorials-extending-qml-chapter5-listproperties-piechart-cpp.html
                      • qtqml-tutorials-extending-qml-chapter5-listproperties-piechart-h.html
                      • qtqml-tutorials-extending-qml-chapter5-listproperties-pieslice-cpp.html
                      • qtqml-tutorials-extending-qml-chapter5-listproperties-pieslice-h.html
                      • qtqml-tutorials-extending-qml-chapter6-plugins-app-pro.html
                      • qtqml-tutorials-extending-qml-chapter6-plugins-app-qml.html
                      • qtqml-tutorials-extending-qml-chapter6-plugins-app-qrc.html
                      • qtqml-tutorials-extending-qml-chapter6-plugins-chapter6-plugins-pro.html
                      • qtqml-tutorials-extending-qml-chapter6-plugins-import-chartsplugin-cpp.html
                      • qtqml-tutorials-extending-qml-chapter6-plugins-import-chartsplugin-h.html
                      • qtqml-tutorials-extending-qml-chapter6-plugins-import-import-pro.html
                      • qtqml-tutorials-extending-qml-chapter6-plugins-import-piechart-cpp.html
                      • qtqml-tutorials-extending-qml-chapter6-plugins-import-piechart-h.html
                      • qtqml-tutorials-extending-qml-chapter6-plugins-import-pieslice-cpp.html
                      • qtqml-tutorials-extending-qml-chapter6-plugins-import-pieslice-h.html
                      • qtqml-tutorials-extending-qml-chapter6-plugins-import-qmldir.html
                      • qtqml-tutorials-extending-qml-example.html
                      • qtqml-tutorials-extending-qml-extending-qml-pro.html
                      • qtqml-typesystem-basictypes.html
                      • qtqml-typesystem-objecttypes.html
                      • qtqml-typesystem-topic.html
                      • qtqml-xmlhttprequest-data-xml.html
                      • qtqml-xmlhttprequest-example.html
                      • qtqml-xmlhttprequest-get-qml.html
                      • qtqml-xmlhttprequest-main-cpp.html
                      • qtqml-xmlhttprequest-xmlhttprequest-pro.html
                      • qtqml-xmlhttprequest-xmlhttprequest-qml.html
                      • qtqml-xmlhttprequest-xmlhttprequest-qmlproject.html
                      • qtqml-xmlhttprequest-xmlhttprequest-qrc.html
                      • qtqml.index
                      • qtqml.qhp
                      • qtqml.qhp.sha1
                      • qtqml.tags
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtquick.qch
                    • qtquick
                      • demos-manifest.xml
                      • examples-manifest.xml
                      • images
                        • 3d-rotation-axis.png
                        • anchorchanges.png
                        • anchor_ordering.png
                        • anchor_ordering_bad.png
                        • animatedimageitem.gif
                        • arrow_bc.png
                        • axisrotation.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • columnlayout.png
                        • custom-geometry-example.png
                        • declarative-adv-tutorial1.png
                        • declarative-adv-tutorial2.png
                        • declarative-adv-tutorial3.png
                        • declarative-adv-tutorial4.gif
                        • declarative-anchors_example.png
                        • declarative-anchors_example2.png
                        • declarative-arcdirection.png
                        • declarative-arcradius.png
                        • declarative-colors.png
                        • declarative-gridmesh.png
                        • declarative-item_opacity1.png
                        • declarative-item_opacity2.png
                        • declarative-item_stacking1.png
                        • declarative-item_stacking2.png
                        • declarative-item_stacking3.png
                        • declarative-item_stacking4.png
                        • declarative-largearc.png
                        • declarative-nopercent.png
                        • declarative-patharc.png
                        • declarative-pathattribute.png
                        • declarative-pathcubic.png
                        • declarative-pathcurve.png
                        • declarative-pathquad.png
                        • declarative-pathsvg.png
                        • declarative-percent.png
                        • declarative-qmlfocus1.png
                        • declarative-qmlfocus2.png
                        • declarative-qmlfocus3.png
                        • declarative-qmlfocus4.png
                        • declarative-qmlfocus5.png
                        • declarative-qtlogo-preserveaspectcrop.png
                        • declarative-qtlogo-preserveaspectfit.png
                        • declarative-qtlogo-stretch.png
                        • declarative-qtlogo-tile.png
                        • declarative-qtlogo-tilehorizontally.png
                        • declarative-qtlogo-tilevertically.png
                        • declarative-qtlogo.png
                        • declarative-rect.png
                        • declarative-rect_gradient.png
                        • declarative-rotation.png
                        • declarative-samegame.png
                        • declarative-scale.png
                        • declarative-scalegrid.png
                        • declarative-shadereffectitem.png
                        • declarative-shadereffectsource.png
                        • declarative-text.png
                        • declarative-textballoons_example.png
                        • declarative-textedit.gif
                        • declarative-textformat.png
                        • declarative-textstyle.png
                        • declarative-transformorigin.png
                        • declarative-tutorial1.png
                        • declarative-tutorial2.png
                        • declarative-tutorial3_animation.gif
                        • edge1.png
                        • edge2.png
                        • edge3.png
                        • edge4.png
                        • edges_qml.png
                        • flickable-rebound.gif
                        • flickable.gif
                        • flipable.gif
                        • fuzzydot.png
                        • glowdot.png
                        • graph-example.jpg
                        • gridlayout.png
                        • gridLayout_aligncenter.png
                        • gridLayout_aligntop.png
                        • gridLayout_aligntopleft.png
                        • gridLayout_example.png
                        • gridview-highlight.png
                        • gridview-layout-lefttoright-ltr-btt.png
                        • gridview-layout-lefttoright-ltr-ttb.png
                        • gridview-layout-lefttoright-rtl-btt.png
                        • gridview-layout-lefttoright-rtl-ttb.png
                        • gridview-layout-toptobottom-ltr-btt.png
                        • gridview-layout-toptobottom-ltr-ttb.png
                        • gridview-layout-toptobottom-rtl-btt.png
                        • gridview-layout-toptobottom-rtl-ttb.png
                        • gridview-simple.png
                        • home.png
                        • horizontalpositioner_example.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • imageprovider.png
                        • layoutmirroring.png
                        • listview-decorations.png
                        • listview-highlight.png
                        • listview-layout-bottomtotop.png
                        • listview-layout-lefttoright.png
                        • listview-layout-righttoleft.png
                        • listview-layout-toptobottom.png
                        • listview-section.png
                        • listview-setup.png
                        • listview-simple.png
                        • ListViewHorizontal.png
                        • logo.png
                        • manual-layout.png
                        • margins_qml.png
                        • mob-idle.png
                        • modelview-overview.png
                        • openglunderqml-example.jpg
                        • parentchange.png
                        • pathview.gif
                        • positioner-example.png
                        • qeasingcurve-inback.png
                        • qeasingcurve-inbounce.png
                        • qeasingcurve-incirc.png
                        • qeasingcurve-incubic.png
                        • qeasingcurve-inelastic.png
                        • qeasingcurve-inexpo.png
                        • qeasingcurve-inoutback.png
                        • qeasingcurve-inoutbounce.png
                        • qeasingcurve-inoutcirc.png
                        • qeasingcurve-inoutcubic.png
                        • qeasingcurve-inoutelastic.png
                        • qeasingcurve-inoutexpo.png
                        • qeasingcurve-inoutquad.png
                        • qeasingcurve-inoutquart.png
                        • qeasingcurve-inoutquint.png
                        • qeasingcurve-inoutsine.png
                        • qeasingcurve-inquad.png
                        • qeasingcurve-inquart.png
                        • qeasingcurve-inquint.png
                        • qeasingcurve-insine.png
                        • qeasingcurve-linear.png
                        • qeasingcurve-outback.png
                        • qeasingcurve-outbounce.png
                        • qeasingcurve-outcirc.png
                        • qeasingcurve-outcubic.png
                        • qeasingcurve-outelastic.png
                        • qeasingcurve-outexpo.png
                        • qeasingcurve-outinback.png
                        • qeasingcurve-outinbounce.png
                        • qeasingcurve-outincirc.png
                        • qeasingcurve-outincubic.png
                        • qeasingcurve-outinelastic.png
                        • qeasingcurve-outinexpo.png
                        • qeasingcurve-outinquad.png
                        • qeasingcurve-outinquart.png
                        • qeasingcurve-outinquint.png
                        • qeasingcurve-outinsine.png
                        • qeasingcurve-outquad.png
                        • qeasingcurve-outquart.png
                        • qeasingcurve-outquint.png
                        • qeasingcurve-outsine.png
                        • qml-abstractitemmodel-example.png
                        • qml-affectors-example.png
                        • qml-animations-example.png
                        • qml-blending-layered.png
                        • qml-blending-nonlayered.png
                        • qml-borderimage-normal-image.png
                        • qml-borderimage-scaled.png
                        • qml-borderimage-tiled.png
                        • qml-canvas-example.png
                        • qml-column.png
                        • qml-customparticle-example.png
                        • qml-dialcontrol-example.png
                        • qml-dnd2-example.png
                        • qml-draganddrop-example.png
                        • qml-emitters-example.png
                        • qml-flipable-example.png
                        • qml-flow-snippet.png
                        • qml-flow-text1.png
                        • qml-flow-text2.png
                        • qml-gradient.png
                        • qml-grid-no-spacing.png
                        • qml-grid-spacing.png
                        • qml-imageelements-example.png
                        • qml-imageparticle-example.png
                        • qml-imageprovider-example.png
                        • qml-item-canvas-arc.png
                        • qml-item-canvas-arcTo.png
                        • qml-item-canvas-bezierCurveTo.png
                        • qml-item-canvas-clip-complex.png
                        • qml-item-canvas-context.gif
                        • qml-item-canvas-math-rotate.png
                        • qml-item-canvas-math.png
                        • qml-item-canvas-rotate.png
                        • qml-item-canvas-scale.png
                        • qml-item-canvas-scalex.png
                        • qml-item-canvas-scaley.png
                        • qml-item-canvas-skewx.png
                        • qml-item-canvas-skewy.png
                        • qml-item-canvas-startAngle.png
                        • qml-item-canvas-translate.png
                        • qml-item-canvas-translatey.png
                        • qml-keyinteraction-example.png
                        • qml-listview-sections-example.png
                        • qml-localstorage-example.png
                        • qml-modelviews-example.png
                        • qml-mousearea-example.png
                        • qml-mousearea-snippet.png
                        • qml-objectlistmodel-example.png
                        • qml-positioners-example.png
                        • qml-righttoleft-example.png
                        • qml-row.png
                        • qml-scrollbar-example.png
                        • qml-shadereffect-layereffect.png
                        • qml-shadereffect-nolayereffect.png
                        • qml-shadereffect-opacitymask.png
                        • qml-shadereffects-example.png
                        • qml-stringlistmodel-example.png
                        • qml-system-example.png
                        • qml-tabwidget-example.png
                        • qml-text-example.png
                        • qml-threading-example.png
                        • qml-touchinteraction-example.png
                        • qml-window-example.png
                        • qml-xmllistmodel-example.png
                        • qtquick-demo-calqlatr.png
                        • qtquick-demo-clocks-small.png
                        • qtquick-demo-maroon-med-1.png
                        • qtquick-demo-maroon-med-2.png
                        • qtquick-demo-maroon-med-3.jpg
                        • qtquick-demo-maroon-med-4.jpg
                        • qtquick-demo-maroon-med-5.jpg
                        • qtquick-demo-maroon-med-6.jpg
                        • qtquick-demo-photosurface-small.png
                        • qtquick-demo-photoviewer-small.png
                        • qtquick-demo-rssnews-small.png
                        • qtquick-demo-samegame-med-1.png
                        • qtquick-demo-samegame-med-2.png
                        • qtquick-demo-stocqt.png
                        • qtquick-demo-tweetsearch-med-1.png
                        • qtquick-demo-tweetsearch-med-2.png
                        • qtquicklayouts-example-layouts.png
                        • qtquickwidgets-example.png
                        • rect-color.png
                        • rendercontrol-example.jpg
                        • repeater-index.png
                        • repeater-modeldata.png
                        • repeater-simple.png
                        • repeater.png
                        • rowlayout-minimum.png
                        • rowlayout.png
                        • screen-and-window-dimensions.jpg
                        • sg-renderloop-singlethreaded.jpg
                        • sg-renderloop-threaded.jpg
                        • simplematerial-example.jpg
                        • spritecutting.png
                        • spriteenginegraph.png
                        • star.png
                        • textureinsgnode-example.jpg
                        • textureinthread-example.jpg
                        • translate.png
                        • twotextureproviders-example.jpg
                        • verticalpositioner_example.png
                        • verticalpositioner_transition.gif
                        • viewtransitions-basic.gif
                        • viewtransitions-delayedbyindex.gif
                        • viewtransitions-intermediatemove.gif
                        • viewtransitions-interruptedbad.gif
                        • viewtransitions-interruptedgood.gif
                        • viewtransitions-pathanim.gif
                        • viewtransitions-scriptactionbad.gif
                        • visual-coordinates-example.png
                        • visual-parent-example.png
                        • visual-parent-example2.png
                        • visualcanvas_list.png
                        • visualcanvas_overlap.png
                        • visualize-batches.png
                        • visualize-clip.png
                        • visualize-original.png
                        • visualize-overdraw-1.png
                        • visualize-overdraw-2.png
                      • qml-advtutorial.html
                      • qml-color.html
                      • qml-dynamicview-tutorial.html
                      • qml-font.html
                      • qml-matrix4x4.html
                      • qml-qt-labs-folderlistmodel-folderlistmodel-members.html
                      • qml-qt-labs-folderlistmodel-folderlistmodel.html
                      • qml-qt-labs-settings-settings-members.html
                      • qml-qt-labs-settings-settings.html
                      • qml-qtquick-accessible-members.html
                      • qml-qtquick-accessible.html
                      • qml-qtquick-anchoranimation-members.html
                      • qml-qtquick-anchoranimation.html
                      • qml-qtquick-anchorchanges-members.html
                      • qml-qtquick-anchorchanges.html
                      • qml-qtquick-animatedimage-members.html
                      • qml-qtquick-animatedimage.html
                      • qml-qtquick-animatedsprite-members.html
                      • qml-qtquick-animatedsprite.html
                      • qml-qtquick-animation-members.html
                      • qml-qtquick-animation.html
                      • qml-qtquick-animationcontroller-members.html
                      • qml-qtquick-animationcontroller.html
                      • qml-qtquick-animator-members.html
                      • qml-qtquick-animator.html
                      • qml-qtquick-behavior-members.html
                      • qml-qtquick-behavior.html
                      • qml-qtquick-borderimage-members.html
                      • qml-qtquick-borderimage.html
                      • qml-qtquick-canvas-members.html
                      • qml-qtquick-canvas-obsolete.html
                      • qml-qtquick-canvas.html
                      • qml-qtquick-canvasgradient-members.html
                      • qml-qtquick-canvasgradient.html
                      • qml-qtquick-canvasimagedata-members.html
                      • qml-qtquick-canvasimagedata.html
                      • qml-qtquick-canvaspixelarray-members.html
                      • qml-qtquick-canvaspixelarray.html
                      • qml-qtquick-coloranimation-members.html
                      • qml-qtquick-coloranimation.html
                      • qml-qtquick-column-members.html
                      • qml-qtquick-column.html
                      • qml-qtquick-context2d-members.html
                      • qml-qtquick-context2d.html
                      • qml-qtquick-doublevalidator-members.html
                      • qml-qtquick-doublevalidator.html
                      • qml-qtquick-drag-members.html
                      • qml-qtquick-drag.html
                      • qml-qtquick-dragevent-members.html
                      • qml-qtquick-dragevent.html
                      • qml-qtquick-droparea-members.html
                      • qml-qtquick-droparea.html
                      • qml-qtquick-enterkey-members.html
                      • qml-qtquick-enterkey.html
                      • qml-qtquick-flickable-members.html
                      • qml-qtquick-flickable.html
                      • qml-qtquick-flipable-members.html
                      • qml-qtquick-flipable.html
                      • qml-qtquick-flow-members.html
                      • qml-qtquick-flow.html
                      • qml-qtquick-focusscope-members.html
                      • qml-qtquick-focusscope.html
                      • qml-qtquick-fontloader-members.html
                      • qml-qtquick-fontloader.html
                      • qml-qtquick-fontmetrics-members.html
                      • qml-qtquick-fontmetrics.html
                      • qml-qtquick-gradient-members.html
                      • qml-qtquick-gradient.html
                      • qml-qtquick-gradientstop-members.html
                      • qml-qtquick-gradientstop.html
                      • qml-qtquick-grid-members.html
                      • qml-qtquick-grid.html
                      • qml-qtquick-gridmesh-members.html
                      • qml-qtquick-gridmesh.html
                      • qml-qtquick-gridview-members.html
                      • qml-qtquick-gridview.html
                      • qml-qtquick-image-members.html
                      • qml-qtquick-image.html
                      • qml-qtquick-intvalidator-members.html
                      • qml-qtquick-intvalidator.html
                      • qml-qtquick-item-members.html
                      • qml-qtquick-item.html
                      • qml-qtquick-itemgrabresult-members.html
                      • qml-qtquick-itemgrabresult.html
                      • qml-qtquick-keyevent-members.html
                      • qml-qtquick-keyevent.html
                      • qml-qtquick-keynavigation-members.html
                      • qml-qtquick-keynavigation.html
                      • qml-qtquick-keys-members.html
                      • qml-qtquick-keys.html
                      • qml-qtquick-layoutmirroring-members.html
                      • qml-qtquick-layoutmirroring.html
                      • qml-qtquick-layouts-columnlayout-members.html
                      • qml-qtquick-layouts-columnlayout.html
                      • qml-qtquick-layouts-gridlayout-members.html
                      • qml-qtquick-layouts-gridlayout.html
                      • qml-qtquick-layouts-layout-members.html
                      • qml-qtquick-layouts-layout.html
                      • qml-qtquick-layouts-rowlayout-members.html
                      • qml-qtquick-layouts-rowlayout.html
                      • qml-qtquick-layouts-stacklayout-members.html
                      • qml-qtquick-layouts-stacklayout.html
                      • qml-qtquick-listview-members.html
                      • qml-qtquick-listview.html
                      • qml-qtquick-loader-members.html
                      • qml-qtquick-loader.html
                      • qml-qtquick-matrix4x4-members.html
                      • qml-qtquick-matrix4x4.html
                      • qml-qtquick-mousearea-members.html
                      • qml-qtquick-mousearea.html
                      • qml-qtquick-mouseevent-members.html
                      • qml-qtquick-mouseevent.html
                      • qml-qtquick-multipointtoucharea-members.html
                      • qml-qtquick-multipointtoucharea.html
                      • qml-qtquick-numberanimation-members.html
                      • qml-qtquick-numberanimation.html
                      • qml-qtquick-opacityanimator-members.html
                      • qml-qtquick-opacityanimator.html
                      • qml-qtquick-openglinfo-members.html
                      • qml-qtquick-openglinfo.html
                      • qml-qtquick-parallelanimation-members.html
                      • qml-qtquick-parallelanimation.html
                      • qml-qtquick-parentanimation-members.html
                      • qml-qtquick-parentanimation.html
                      • qml-qtquick-parentchange-members.html
                      • qml-qtquick-parentchange.html
                      • qml-qtquick-particles-affector-members.html
                      • qml-qtquick-particles-affector.html
                      • qml-qtquick-particles-age-members.html
                      • qml-qtquick-particles-age.html
                      • qml-qtquick-particles-angledirection-members.html
                      • qml-qtquick-particles-angledirection.html
                      • qml-qtquick-particles-attractor-members.html
                      • qml-qtquick-particles-attractor.html
                      • qml-qtquick-particles-cumulativedirection-members.html
                      • qml-qtquick-particles-cumulativedirection.html
                      • qml-qtquick-particles-customparticle-members.html
                      • qml-qtquick-particles-customparticle.html
                      • qml-qtquick-particles-direction-members.html
                      • qml-qtquick-particles-direction.html
                      • qml-qtquick-particles-ellipseshape-members.html
                      • qml-qtquick-particles-ellipseshape.html
                      • qml-qtquick-particles-emitter-members.html
                      • qml-qtquick-particles-emitter.html
                      • qml-qtquick-particles-friction-members.html
                      • qml-qtquick-particles-friction.html
                      • qml-qtquick-particles-gravity-members.html
                      • qml-qtquick-particles-gravity.html
                      • qml-qtquick-particles-groupgoal-members.html
                      • qml-qtquick-particles-groupgoal.html
                      • qml-qtquick-particles-imageparticle-members.html
                      • qml-qtquick-particles-imageparticle.html
                      • qml-qtquick-particles-itemparticle-members.html
                      • qml-qtquick-particles-itemparticle.html
                      • qml-qtquick-particles-lineshape-members.html
                      • qml-qtquick-particles-lineshape.html
                      • qml-qtquick-particles-maskshape-members.html
                      • qml-qtquick-particles-maskshape.html
                      • qml-qtquick-particles-particle-members.html
                      • qml-qtquick-particles-particle.html
                      • qml-qtquick-particles-particlegroup-members.html
                      • qml-qtquick-particles-particlegroup.html
                      • qml-qtquick-particles-particlepainter-members.html
                      • qml-qtquick-particles-particlepainter.html
                      • qml-qtquick-particles-particlesystem-members.html
                      • qml-qtquick-particles-particlesystem.html
                      • qml-qtquick-particles-pointdirection-members.html
                      • qml-qtquick-particles-pointdirection.html
                      • qml-qtquick-particles-rectangleshape-members.html
                      • qml-qtquick-particles-rectangleshape.html
                      • qml-qtquick-particles-shape-members.html
                      • qml-qtquick-particles-shape.html
                      • qml-qtquick-particles-spritegoal-members.html
                      • qml-qtquick-particles-spritegoal.html
                      • qml-qtquick-particles-targetdirection-members.html
                      • qml-qtquick-particles-targetdirection.html
                      • qml-qtquick-particles-trailemitter-members.html
                      • qml-qtquick-particles-trailemitter.html
                      • qml-qtquick-particles-turbulence-members.html
                      • qml-qtquick-particles-turbulence.html
                      • qml-qtquick-particles-wander-members.html
                      • qml-qtquick-particles-wander.html
                      • qml-qtquick-path-members.html
                      • qml-qtquick-path.html
                      • qml-qtquick-pathanimation-members.html
                      • qml-qtquick-pathanimation.html
                      • qml-qtquick-patharc-members.html
                      • qml-qtquick-patharc.html
                      • qml-qtquick-pathattribute-members.html
                      • qml-qtquick-pathattribute.html
                      • qml-qtquick-pathcubic-members.html
                      • qml-qtquick-pathcubic.html
                      • qml-qtquick-pathcurve-members.html
                      • qml-qtquick-pathcurve.html
                      • qml-qtquick-pathelement-members.html
                      • qml-qtquick-pathelement.html
                      • qml-qtquick-pathinterpolator-members.html
                      • qml-qtquick-pathinterpolator.html
                      • qml-qtquick-pathline-members.html
                      • qml-qtquick-pathline.html
                      • qml-qtquick-pathpercent-members.html
                      • qml-qtquick-pathpercent.html
                      • qml-qtquick-pathquad-members.html
                      • qml-qtquick-pathquad.html
                      • qml-qtquick-pathsvg-members.html
                      • qml-qtquick-pathsvg.html
                      • qml-qtquick-pathview-members.html
                      • qml-qtquick-pathview.html
                      • qml-qtquick-pauseanimation-members.html
                      • qml-qtquick-pauseanimation.html
                      • qml-qtquick-pincharea-members.html
                      • qml-qtquick-pincharea.html
                      • qml-qtquick-pinchevent-members.html
                      • qml-qtquick-pinchevent.html
                      • qml-qtquick-positioner-members.html
                      • qml-qtquick-positioner.html
                      • qml-qtquick-propertyaction-members.html
                      • qml-qtquick-propertyaction.html
                      • qml-qtquick-propertyanimation-members.html
                      • qml-qtquick-propertyanimation.html
                      • qml-qtquick-propertychanges-members.html
                      • qml-qtquick-propertychanges.html
                      • qml-qtquick-rectangle-members.html
                      • qml-qtquick-rectangle.html
                      • qml-qtquick-regexpvalidator-members.html
                      • qml-qtquick-regexpvalidator.html
                      • qml-qtquick-repeater-members.html
                      • qml-qtquick-repeater.html
                      • qml-qtquick-rotation-members.html
                      • qml-qtquick-rotation.html
                      • qml-qtquick-rotationanimation-members.html
                      • qml-qtquick-rotationanimation.html
                      • qml-qtquick-rotationanimator-members.html
                      • qml-qtquick-rotationanimator.html
                      • qml-qtquick-row-members.html
                      • qml-qtquick-row.html
                      • qml-qtquick-scale-members.html
                      • qml-qtquick-scale.html
                      • qml-qtquick-scaleanimator-members.html
                      • qml-qtquick-scaleanimator.html
                      • qml-qtquick-scriptaction-members.html
                      • qml-qtquick-scriptaction.html
                      • qml-qtquick-sequentialanimation-members.html
                      • qml-qtquick-sequentialanimation.html
                      • qml-qtquick-shadereffect-members.html
                      • qml-qtquick-shadereffect.html
                      • qml-qtquick-shadereffectsource-members.html
                      • qml-qtquick-shadereffectsource.html
                      • qml-qtquick-shortcut-members.html
                      • qml-qtquick-shortcut.html
                      • qml-qtquick-smoothedanimation-members.html
                      • qml-qtquick-smoothedanimation.html
                      • qml-qtquick-springanimation-members.html
                      • qml-qtquick-springanimation.html
                      • qml-qtquick-sprite-members.html
                      • qml-qtquick-sprite.html
                      • qml-qtquick-spritesequence-members.html
                      • qml-qtquick-spritesequence.html
                      • qml-qtquick-state-members.html
                      • qml-qtquick-state.html
                      • qml-qtquick-statechangescript-members.html
                      • qml-qtquick-statechangescript.html
                      • qml-qtquick-stategroup-members.html
                      • qml-qtquick-stategroup.html
                      • qml-qtquick-systempalette-members.html
                      • qml-qtquick-systempalette.html
                      • qml-qtquick-text-members.html
                      • qml-qtquick-text.html
                      • qml-qtquick-textedit-members.html
                      • qml-qtquick-textedit.html
                      • qml-qtquick-textinput-members.html
                      • qml-qtquick-textinput.html
                      • qml-qtquick-textmetrics-members.html
                      • qml-qtquick-textmetrics.html
                      • qml-qtquick-touchpoint-members.html
                      • qml-qtquick-touchpoint.html
                      • qml-qtquick-transform-members.html
                      • qml-qtquick-transform.html
                      • qml-qtquick-transition-members.html
                      • qml-qtquick-transition.html
                      • qml-qtquick-translate-members.html
                      • qml-qtquick-translate.html
                      • qml-qtquick-uniformanimator-members.html
                      • qml-qtquick-uniformanimator.html
                      • qml-qtquick-vector3danimation-members.html
                      • qml-qtquick-vector3danimation.html
                      • qml-qtquick-viewtransition-members.html
                      • qml-qtquick-viewtransition.html
                      • qml-qtquick-wheelevent-members.html
                      • qml-qtquick-wheelevent.html
                      • qml-qtquick-window-closeevent-members.html
                      • qml-qtquick-window-closeevent.html
                      • qml-qtquick-window-screen-members.html
                      • qml-qtquick-window-screen-obsolete.html
                      • qml-qtquick-window-screen.html
                      • qml-qtquick-window-window-members.html
                      • qml-qtquick-window-window.html
                      • qml-qtquick-xanimator-members.html
                      • qml-qtquick-xanimator.html
                      • qml-qtquick-xmllistmodel-xmllistmodel-members.html
                      • qml-qtquick-xmllistmodel-xmllistmodel.html
                      • qml-qtquick-xmllistmodel-xmlrole-members.html
                      • qml-qtquick-xmllistmodel-xmlrole.html
                      • qml-qtquick-yanimator-members.html
                      • qml-qtquick-yanimator.html
                      • qml-qttest-signalspy-members.html
                      • qml-qttest-signalspy.html
                      • qml-qttest-testcase-members.html
                      • qml-qttest-testcase.html
                      • qml-quaternion.html
                      • qml-tutorial.html
                      • qml-tutorial1.html
                      • qml-tutorial2.html
                      • qml-tutorial3.html
                      • qml-vector2d.html
                      • qml-vector3d.html
                      • qml-vector4d.html
                      • qmlexampletoggleswitch.html
                      • qquickasyncimageprovider-members.html
                      • qquickasyncimageprovider.html
                      • qquickframebufferobject-members.html
                      • qquickframebufferobject-renderer-members.html
                      • qquickframebufferobject-renderer.html
                      • qquickframebufferobject.html
                      • qquickimageprovider-members.html
                      • qquickimageprovider.html
                      • qquickimageresponse-members.html
                      • qquickimageresponse.html
                      • qquickitem-itemchangedata-members.html
                      • qquickitem-itemchangedata.html
                      • qquickitem-members.html
                      • qquickitem-updatepaintnodedata-members.html
                      • qquickitem-updatepaintnodedata.html
                      • qquickitem.html
                      • qquickitemgrabresult-members.html
                      • qquickitemgrabresult.html
                      • qquickpainteditem-members.html
                      • qquickpainteditem-obsolete.html
                      • qquickpainteditem.html
                      • qquickrendercontrol-members.html
                      • qquickrendercontrol.html
                      • qquicktextdocument-members.html
                      • qquicktextdocument.html
                      • qquicktexturefactory-members.html
                      • qquicktexturefactory.html
                      • qquickview-members.html
                      • qquickview.html
                      • qquickwidget-members.html
                      • qquickwidget.html
                      • qquickwindow-members.html
                      • qquickwindow.html
                      • qsgabstractrenderer-members.html
                      • qsgabstractrenderer.html
                      • qsgbasicgeometrynode-members.html
                      • qsgbasicgeometrynode.html
                      • qsgclipnode-members.html
                      • qsgclipnode.html
                      • qsgdynamictexture-members.html
                      • qsgdynamictexture.html
                      • qsgengine-members.html
                      • qsgengine.html
                      • qsgflatcolormaterial-members.html
                      • qsgflatcolormaterial.html
                      • qsggeometry-attribute-members.html
                      • qsggeometry-attribute.html
                      • qsggeometry-attributeset-members.html
                      • qsggeometry-attributeset.html
                      • qsggeometry-coloredpoint2d-members.html
                      • qsggeometry-coloredpoint2d.html
                      • qsggeometry-members.html
                      • qsggeometry-point2d-members.html
                      • qsggeometry-point2d.html
                      • qsggeometry-texturedpoint2d-members.html
                      • qsggeometry-texturedpoint2d.html
                      • qsggeometry.html
                      • qsggeometrynode-members.html
                      • qsggeometrynode.html
                      • qsgmaterial-members.html
                      • qsgmaterial.html
                      • qsgmaterialshader-members.html
                      • qsgmaterialshader-renderstate-members.html
                      • qsgmaterialshader-renderstate.html
                      • qsgmaterialshader.html
                      • qsgmaterialtype.html
                      • qsgnode-members.html
                      • qsgnode.html
                      • qsgopacitynode-members.html
                      • qsgopacitynode.html
                      • qsgopaquetexturematerial-members.html
                      • qsgopaquetexturematerial.html
                      • qsgsimplematerial-members.html
                      • qsgsimplematerial.html
                      • qsgsimplematerialshader-members.html
                      • qsgsimplematerialshader.html
                      • qsgsimplerectnode-members.html
                      • qsgsimplerectnode.html
                      • qsgsimpletexturenode-members.html
                      • qsgsimpletexturenode.html
                      • qsgtexture-members.html
                      • qsgtexture.html
                      • qsgtexturematerial-members.html
                      • qsgtexturematerial.html
                      • qsgtextureprovider-members.html
                      • qsgtextureprovider.html
                      • qsgtransformnode-members.html
                      • qsgtransformnode.html
                      • qsgvertexcolormaterial-members.html
                      • qsgvertexcolormaterial.html
                      • qt-labs-folderlistmodel-qmlmodule.html
                      • qt-labs-settings-qmlmodule.html
                      • qtquick-animation-animation-pro.html
                      • qtquick-animation-animation-qml.html
                      • qtquick-animation-animation-qmlproject.html
                      • qtquick-animation-animation-qrc.html
                      • qtquick-animation-basics-animators-qml.html
                      • qtquick-animation-basics-color-animation-qml.html
                      • qtquick-animation-basics-property-animation-qml.html
                      • qtquick-animation-behaviors-behavior-example-qml.html
                      • qtquick-animation-behaviors-siderect-qml.html
                      • qtquick-animation-behaviors-tvtennis-qml.html
                      • qtquick-animation-behaviors-wigglytext-qml.html
                      • qtquick-animation-easing-easing-qml.html
                      • qtquick-animation-example.html
                      • qtquick-animation-main-cpp.html
                      • qtquick-animation-pathanimation-pathanimation-qml.html
                      • qtquick-animation-pathinterpolator-pathinterpolator-qml.html
                      • qtquick-animation-states-states-qml.html
                      • qtquick-animation-states-transitions-qml.html
                      • qtquick-canvas-beziercurve-beziercurve-qml.html
                      • qtquick-canvas-canvas-pro.html
                      • qtquick-canvas-canvas-qml.html
                      • qtquick-canvas-canvas-qrc.html
                      • qtquick-canvas-clip-clip-qml.html
                      • qtquick-canvas-example.html
                      • qtquick-canvas-main-cpp.html
                      • qtquick-canvas-quadraticcurveto-quadraticcurveto-qml.html
                      • qtquick-canvas-roundedrect-roundedrect-qml.html
                      • qtquick-canvas-smile-smile-qml.html
                      • qtquick-canvas-squircle-squircle-qml.html
                      • qtquick-canvas-tiger-tiger-js.html
                      • qtquick-canvas-tiger-tiger-qml.html
                      • qtquick-codesamples.html
                      • qtquick-convenience-topic.html
                      • qtquick-cppextensionpoints.html
                      • qtquick-customitems-dialcontrol-content-dial-qml.html
                      • qtquick-customitems-dialcontrol-content-quitbutton-qml.html
                      • qtquick-customitems-dialcontrol-dialcontrol-pro.html
                      • qtquick-customitems-dialcontrol-dialcontrol-qml.html
                      • qtquick-customitems-dialcontrol-dialcontrol-qmlproject.html
                      • qtquick-customitems-dialcontrol-dialcontrol-qrc.html
                      • qtquick-customitems-dialcontrol-example.html
                      • qtquick-customitems-dialcontrol-main-cpp.html
                      • qtquick-customitems-flipable-content-card-qml.html
                      • qtquick-customitems-flipable-example.html
                      • qtquick-customitems-flipable-flipable-qml.html
                      • qtquick-customitems-flipable-flipable-qmlproject.html
                      • qtquick-customitems-painteditem-example.html
                      • qtquick-customitems-painteditem-painteditem-pro.html
                      • qtquick-customitems-painteditem-painteditem-qrc.html
                      • qtquick-customitems-painteditem-textballoon-cpp.html
                      • qtquick-customitems-painteditem-textballoon-h.html
                      • qtquick-customitems-painteditem-textballoonplugin-plugin-h.html
                      • qtquick-customitems-painteditem-textballoonplugin-qmldir.html
                      • qtquick-customitems-painteditem-textballoons-qml.html
                      • qtquick-customitems-scrollbar-example.html
                      • qtquick-customitems-scrollbar-main-qml.html
                      • qtquick-customitems-scrollbar-scrollbar-qml.html
                      • qtquick-customitems-scrollbar-scrollbar-qmlproject.html
                      • qtquick-customitems-tabwidget-example.html
                      • qtquick-customitems-tabwidget-main-qml.html
                      • qtquick-customitems-tabwidget-tabwidget-qml.html
                      • qtquick-customitems-tabwidget-tabwidget-qmlproject.html
                      • qtquick-demos-calqlatr-calqlatr-pro.html
                      • qtquick-demos-calqlatr-calqlatr-qml.html
                      • qtquick-demos-calqlatr-calqlatr-qmlproject.html
                      • qtquick-demos-calqlatr-calqlatr-qrc.html
                      • qtquick-demos-calqlatr-content-button-qml.html
                      • qtquick-demos-calqlatr-content-calculator-js.html
                      • qtquick-demos-calqlatr-content-display-qml.html
                      • qtquick-demos-calqlatr-content-numberpad-qml.html
                      • qtquick-demos-calqlatr-example.html
                      • qtquick-demos-calqlatr-main-cpp.html
                      • qtquick-demos-clocks-clocks-pro.html
                      • qtquick-demos-clocks-clocks-qml.html
                      • qtquick-demos-clocks-clocks-qmlproject.html
                      • qtquick-demos-clocks-clocks-qrc.html
                      • qtquick-demos-clocks-content-clock-qml.html
                      • qtquick-demos-clocks-example.html
                      • qtquick-demos-clocks-main-cpp.html
                      • qtquick-demos-maroon-content-buildbutton-qml.html
                      • qtquick-demos-maroon-content-gamecanvas-qml.html
                      • qtquick-demos-maroon-content-gameoverscreen-qml.html
                      • qtquick-demos-maroon-content-infobar-qml.html
                      • qtquick-demos-maroon-content-logic-js.html
                      • qtquick-demos-maroon-content-mobs-mobbase-qml.html
                      • qtquick-demos-maroon-content-newgamescreen-qml.html
                      • qtquick-demos-maroon-content-soundeffect-qml.html
                      • qtquick-demos-maroon-content-towers-bomb-qml.html
                      • qtquick-demos-maroon-content-towers-factory-qml.html
                      • qtquick-demos-maroon-content-towers-melee-qml.html
                      • qtquick-demos-maroon-content-towers-ranged-qml.html
                      • qtquick-demos-maroon-content-towers-towerbase-qml.html
                      • qtquick-demos-maroon-example.html
                      • qtquick-demos-maroon-main-cpp.html
                      • qtquick-demos-maroon-maroon-pro.html
                      • qtquick-demos-maroon-maroon-qml.html
                      • qtquick-demos-maroon-maroon-qmlproject.html
                      • qtquick-demos-maroon-maroon-qrc.html
                      • qtquick-demos-photosurface-example.html
                      • qtquick-demos-photosurface-main-cpp.html
                      • qtquick-demos-photosurface-photosurface-pro.html
                      • qtquick-demos-photosurface-photosurface-qml.html
                      • qtquick-demos-photosurface-photosurface-qmlproject.html
                      • qtquick-demos-photosurface-photosurface-qrc.html
                      • qtquick-demos-photoviewer-example.html
                      • qtquick-demos-photoviewer-i18n-qml-de-qm.html
                      • qtquick-demos-photoviewer-i18n-qml-fr-qm.html
                      • qtquick-demos-photoviewer-main-cpp.html
                      • qtquick-demos-photoviewer-main-qml.html
                      • qtquick-demos-photoviewer-photoviewer-pro.html
                      • qtquick-demos-photoviewer-photoviewercore-albumdelegate-qml.html
                      • qtquick-demos-photoviewer-photoviewercore-busyindicator-qml.html
                      • qtquick-demos-photoviewer-photoviewercore-button-qml.html
                      • qtquick-demos-photoviewer-photoviewercore-editablebutton-qml.html
                      • qtquick-demos-photoviewer-photoviewercore-photodelegate-qml.html
                      • qtquick-demos-photoviewer-photoviewercore-progressbar-qml.html
                      • qtquick-demos-photoviewer-photoviewercore-rssmodel-qml.html
                      • qtquick-demos-photoviewer-photoviewercore-script-script-js.html
                      • qtquick-demos-photoviewer-photoviewercore-tag-qml.html
                      • qtquick-demos-photoviewer-qml-qrc.html
                      • qtquick-demos-rssnews-content-busyindicator-qml.html
                      • qtquick-demos-rssnews-content-categorydelegate-qml.html
                      • qtquick-demos-rssnews-content-newsdelegate-qml.html
                      • qtquick-demos-rssnews-content-rssfeeds-qml.html
                      • qtquick-demos-rssnews-content-scrollbar-qml.html
                      • qtquick-demos-rssnews-example.html
                      • qtquick-demos-rssnews-main-cpp.html
                      • qtquick-demos-rssnews-rssnews-pro.html
                      • qtquick-demos-rssnews-rssnews-qml.html
                      • qtquick-demos-rssnews-rssnews-qmlproject.html
                      • qtquick-demos-rssnews-rssnews-qrc.html
                      • qtquick-demos-samegame-content-bbsettings-qml.html
                      • qtquick-demos-samegame-content-blackberry-settings-qml.html
                      • qtquick-demos-samegame-content-block-qml.html
                      • qtquick-demos-samegame-content-blockemitter-qml.html
                      • qtquick-demos-samegame-content-button-qml.html
                      • qtquick-demos-samegame-content-gamearea-qml.html
                      • qtquick-demos-samegame-content-levels-level0-qml.html
                      • qtquick-demos-samegame-content-levels-level1-qml.html
                      • qtquick-demos-samegame-content-levels-level2-qml.html
                      • qtquick-demos-samegame-content-levels-level3-qml.html
                      • qtquick-demos-samegame-content-levels-level4-qml.html
                      • qtquick-demos-samegame-content-levels-level5-qml.html
                      • qtquick-demos-samegame-content-levels-level6-qml.html
                      • qtquick-demos-samegame-content-levels-level7-qml.html
                      • qtquick-demos-samegame-content-levels-level8-qml.html
                      • qtquick-demos-samegame-content-levels-level9-qml.html
                      • qtquick-demos-samegame-content-levels-templatebase-qml.html
                      • qtquick-demos-samegame-content-logoanimation-qml.html
                      • qtquick-demos-samegame-content-menuemitter-qml.html
                      • qtquick-demos-samegame-content-paintemitter-qml.html
                      • qtquick-demos-samegame-content-primarypack-qml.html
                      • qtquick-demos-samegame-content-puzzleblock-qml.html
                      • qtquick-demos-samegame-content-qmldir.html
                      • qtquick-demos-samegame-content-samegame-js.html
                      • qtquick-demos-samegame-content-samegametext-qml.html
                      • qtquick-demos-samegame-content-settings-qml.html
                      • qtquick-demos-samegame-content-simpleblock-qml.html
                      • qtquick-demos-samegame-content-smoketext-qml.html
                      • qtquick-demos-samegame-example.html
                      • qtquick-demos-samegame-main-cpp.html
                      • qtquick-demos-samegame-samegame-pro.html
                      • qtquick-demos-samegame-samegame-qml.html
                      • qtquick-demos-samegame-samegame-qmlproject.html
                      • qtquick-demos-samegame-samegame-qrc.html
                      • qtquick-demos-stocqt-content-button-qml.html
                      • qtquick-demos-stocqt-content-checkbox-qml.html
                      • qtquick-demos-stocqt-content-qmldir.html
                      • qtquick-demos-stocqt-content-settings-qml.html
                      • qtquick-demos-stocqt-content-stockchart-qml.html
                      • qtquick-demos-stocqt-content-stockinfo-qml.html
                      • qtquick-demos-stocqt-content-stocklistmodel-qml.html
                      • qtquick-demos-stocqt-content-stocklistview-qml.html
                      • qtquick-demos-stocqt-content-stockmodel-qml.html
                      • qtquick-demos-stocqt-content-stocksettingspanel-qml.html
                      • qtquick-demos-stocqt-content-stockview-qml.html
                      • qtquick-demos-stocqt-content-windows-settings-qml.html
                      • qtquick-demos-stocqt-example.html
                      • qtquick-demos-stocqt-main-cpp.html
                      • qtquick-demos-stocqt-stocqt-pro.html
                      • qtquick-demos-stocqt-stocqt-qml.html
                      • qtquick-demos-stocqt-stocqt-qmlproject.html
                      • qtquick-demos-stocqt-stocqt-qrc.html
                      • qtquick-demos-tweetsearch-content-flipbar-qml.html
                      • qtquick-demos-tweetsearch-content-lineinput-qml.html
                      • qtquick-demos-tweetsearch-content-listfooter-qml.html
                      • qtquick-demos-tweetsearch-content-listheader-qml.html
                      • qtquick-demos-tweetsearch-content-searchdelegate-qml.html
                      • qtquick-demos-tweetsearch-content-tweetdelegate-qml.html
                      • qtquick-demos-tweetsearch-content-tweetsearch-js.html
                      • qtquick-demos-tweetsearch-content-tweetsmodel-qml.html
                      • qtquick-demos-tweetsearch-example.html
                      • qtquick-demos-tweetsearch-main-cpp.html
                      • qtquick-demos-tweetsearch-tweetsearch-pro.html
                      • qtquick-demos-tweetsearch-tweetsearch-qml.html
                      • qtquick-demos-tweetsearch-tweetsearch-qmlproject.html
                      • qtquick-demos-tweetsearch-tweetsearch-qrc.html
                      • qtquick-draganddrop-draganddrop-pro.html
                      • qtquick-draganddrop-draganddrop-qml.html
                      • qtquick-draganddrop-draganddrop-qmlproject.html
                      • qtquick-draganddrop-draganddrop-qrc.html
                      • qtquick-draganddrop-example.html
                      • qtquick-draganddrop-main-cpp.html
                      • qtquick-draganddrop-tiles-dragtile-qml.html
                      • qtquick-draganddrop-tiles-droptile-qml.html
                      • qtquick-draganddrop-tiles-tiles-qml.html
                      • qtquick-draganddrop-views-gridview-qml.html
                      • qtquick-effects-particles.html
                      • qtquick-effects-sprites.html
                      • qtquick-effects-topic.html
                      • qtquick-effects-transformations.html
                      • qtquick-externaldraganddrop-draganddroptextitem-qml.html
                      • qtquick-externaldraganddrop-example.html
                      • qtquick-externaldraganddrop-externaldraganddrop-pro.html
                      • qtquick-externaldraganddrop-externaldraganddrop-qml.html
                      • qtquick-externaldraganddrop-externaldraganddrop-qmlproject.html
                      • qtquick-externaldraganddrop-externaldraganddrop-qrc.html
                      • qtquick-externaldraganddrop-main-cpp.html
                      • qtquick-imageelements-animatedsprite-qml.html
                      • qtquick-imageelements-borderimage-qml.html
                      • qtquick-imageelements-content-borderimageselector-qml.html
                      • qtquick-imageelements-content-imagecell-qml.html
                      • qtquick-imageelements-content-myborderimage-qml.html
                      • qtquick-imageelements-content-shadowrectangle-qml.html
                      • qtquick-imageelements-example.html
                      • qtquick-imageelements-image-qml.html
                      • qtquick-imageelements-imageelements-pro.html
                      • qtquick-imageelements-imageelements-qml.html
                      • qtquick-imageelements-imageelements-qmlproject.html
                      • qtquick-imageelements-imageelements-qrc.html
                      • qtquick-imageelements-main-cpp.html
                      • qtquick-imageelements-shadows-qml.html
                      • qtquick-imageelements-spritesequence-qml.html
                      • qtquick-imageprovider-example.html
                      • qtquick-imageprovider-imageprovider-cpp.html
                      • qtquick-imageprovider-imageprovider-example-qml.html
                      • qtquick-imageprovider-imageprovider-pro.html
                      • qtquick-imageprovider-imageprovider-qmlproject.html
                      • qtquick-imageprovider-imageprovidercore-qmldir.html
                      • qtquick-imageresponseprovider-example.html
                      • qtquick-imageresponseprovider-imageresponseprovider-cpp.html
                      • qtquick-imageresponseprovider-imageresponseprovider-example-qml.html
                      • qtquick-imageresponseprovider-imageresponseprovider-pro.html
                      • qtquick-imageresponseprovider-imageresponseprovider-qmlproject.html
                      • qtquick-imageresponseprovider-imageresponseprovidercore-qmldir.html
                      • qtquick-index.html
                      • qtquick-input-focus.html
                      • qtquick-input-mouseevents.html
                      • qtquick-input-textinput.html
                      • qtquick-input-topic.html
                      • qtquick-keyinteraction-example.html
                      • qtquick-keyinteraction-focus-core-contextmenu-qml.html
                      • qtquick-keyinteraction-focus-core-gridmenu-qml.html
                      • qtquick-keyinteraction-focus-core-listmenu-qml.html
                      • qtquick-keyinteraction-focus-core-listviewdelegate-qml.html
                      • qtquick-keyinteraction-focus-core-tabmenu-qml.html
                      • qtquick-keyinteraction-focus-focus-qml.html
                      • qtquick-keyinteraction-keyinteraction-pro.html
                      • qtquick-keyinteraction-keyinteraction-qml.html
                      • qtquick-keyinteraction-keyinteraction-qmlproject.html
                      • qtquick-keyinteraction-keyinteraction-qrc.html
                      • qtquick-keyinteraction-main-cpp.html
                      • qtquick-layouts-example.html
                      • qtquick-layouts-layouts-pro.html
                      • qtquick-layouts-layouts-qml.html
                      • qtquick-layouts-layouts-qmlproject.html
                      • qtquick-layouts-layouts-qrc.html
                      • qtquick-layouts-main-cpp.html
                      • qtquick-layouts-qmlmodule.html
                      • qtquick-localstorage-example.html
                      • qtquick-localstorage-localstorage-hello-qml.html
                      • qtquick-localstorage-localstorage-localstorage-pro.html
                      • qtquick-localstorage-localstorage-localstorage-qml.html
                      • qtquick-localstorage-localstorage-localstorage-qmlproject.html
                      • qtquick-localstorage-localstorage-localstorage-qrc.html
                      • qtquick-localstorage-localstorage-main-cpp.html
                      • qtquick-localstorage-localstorage-pro.html
                      • qtquick-localstorage-qmlmodule.html
                      • qtquick-models-abstractitemmodel-abstractitemmodel-pro.html
                      • qtquick-models-abstractitemmodel-abstractitemmodel-qrc.html
                      • qtquick-models-abstractitemmodel-example.html
                      • qtquick-models-abstractitemmodel-main-cpp.html
                      • qtquick-models-abstractitemmodel-model-cpp.html
                      • qtquick-models-abstractitemmodel-model-h.html
                      • qtquick-models-abstractitemmodel-view-qml.html
                      • qtquick-models-objectlistmodel-dataobject-cpp.html
                      • qtquick-models-objectlistmodel-dataobject-h.html
                      • qtquick-models-objectlistmodel-example.html
                      • qtquick-models-objectlistmodel-main-cpp.html
                      • qtquick-models-objectlistmodel-objectlistmodel-pro.html
                      • qtquick-models-objectlistmodel-objectlistmodel-qrc.html
                      • qtquick-models-objectlistmodel-view-qml.html
                      • qtquick-models-stringlistmodel-example.html
                      • qtquick-models-stringlistmodel-main-cpp.html
                      • qtquick-models-stringlistmodel-stringlistmodel-pro.html
                      • qtquick-models-stringlistmodel-stringlistmodel-qrc.html
                      • qtquick-models-stringlistmodel-view-qml.html
                      • qtquick-modelviewsdata-cppmodels.html
                      • qtquick-modelviewsdata-modelview.html
                      • qtquick-modelviewsdata-topic.html
                      • qtquick-module.html
                      • qtquick-mousearea-example.html
                      • qtquick-mousearea-main-cpp.html
                      • qtquick-mousearea-mousearea-pro.html
                      • qtquick-mousearea-mousearea-qml.html
                      • qtquick-mousearea-mousearea-qmlproject.html
                      • qtquick-mousearea-mousearea-qrc.html
                      • qtquick-mousearea-mousearea-wheel-example-qml.html
                      • qtquick-particles-affectors-affectors-pro.html
                      • qtquick-particles-affectors-affectors-qml.html
                      • qtquick-particles-affectors-affectors-qmlproject.html
                      • qtquick-particles-affectors-affectors-qrc.html
                      • qtquick-particles-affectors-content-age-qml.html
                      • qtquick-particles-affectors-content-attractor-qml.html
                      • qtquick-particles-affectors-content-customaffector-qml.html
                      • qtquick-particles-affectors-content-friction-qml.html
                      • qtquick-particles-affectors-content-gravity-qml.html
                      • qtquick-particles-affectors-content-greybutton-qml.html
                      • qtquick-particles-affectors-content-groupgoal-qml.html
                      • qtquick-particles-affectors-content-move-qml.html
                      • qtquick-particles-affectors-content-spritegoal-qml.html
                      • qtquick-particles-affectors-content-turbulence-qml.html
                      • qtquick-particles-affectors-content-wander-qml.html
                      • qtquick-particles-affectors-example.html
                      • qtquick-particles-affectors-main-cpp.html
                      • qtquick-particles-customparticle-content-blurparticles-qml.html
                      • qtquick-particles-customparticle-content-fragmentshader-qml.html
                      • qtquick-particles-customparticle-content-imagecolors-qml.html
                      • qtquick-particles-customparticle-customparticle-pro.html
                      • qtquick-particles-customparticle-customparticle-qml.html
                      • qtquick-particles-customparticle-customparticle-qmlproject.html
                      • qtquick-particles-customparticle-customparticle-qrc.html
                      • qtquick-particles-customparticle-example.html
                      • qtquick-particles-customparticle-main-cpp.html
                      • qtquick-particles-emitters-content-burstandpulse-qml.html
                      • qtquick-particles-emitters-content-customemitter-qml.html
                      • qtquick-particles-emitters-content-emitmask-qml.html
                      • qtquick-particles-emitters-content-maximumemitted-qml.html
                      • qtquick-particles-emitters-content-shapeanddirection-qml.html
                      • qtquick-particles-emitters-content-trailemitter-qml.html
                      • qtquick-particles-emitters-content-velocityfrommotion-qml.html
                      • qtquick-particles-emitters-emitters-pro.html
                      • qtquick-particles-emitters-emitters-qml.html
                      • qtquick-particles-emitters-emitters-qmlproject.html
                      • qtquick-particles-emitters-emitters-qrc.html
                      • qtquick-particles-emitters-example.html
                      • qtquick-particles-emitters-main-cpp.html
                      • qtquick-particles-imageparticle-content-allatonce-qml.html
                      • qtquick-particles-imageparticle-content-colored-qml.html
                      • qtquick-particles-imageparticle-content-colortable-qml.html
                      • qtquick-particles-imageparticle-content-deformation-qml.html
                      • qtquick-particles-imageparticle-content-rotation-qml.html
                      • qtquick-particles-imageparticle-content-sharing-qml.html
                      • qtquick-particles-imageparticle-content-sprites-qml.html
                      • qtquick-particles-imageparticle-example.html
                      • qtquick-particles-imageparticle-imageparticle-pro.html
                      • qtquick-particles-imageparticle-imageparticle-qml.html
                      • qtquick-particles-imageparticle-imageparticle-qmlproject.html
                      • qtquick-particles-imageparticle-imageparticle-qrc.html
                      • qtquick-particles-imageparticle-main-cpp.html
                      • qtquick-particles-performance.html
                      • qtquick-particles-qmlmodule.html
                      • qtquick-particles-system-content-dynamiccomparison-qml.html
                      • qtquick-particles-system-content-dynamicemitters-qml.html
                      • qtquick-particles-system-content-multiplepainters-qml.html
                      • qtquick-particles-system-content-startstop-qml.html
                      • qtquick-particles-system-content-timedgroupchanges-qml.html
                      • qtquick-particles-system-example.html
                      • qtquick-particles-system-main-cpp.html
                      • qtquick-particles-system-system-pro.html
                      • qtquick-particles-system-system-qml.html
                      • qtquick-particles-system-system-qmlproject.html
                      • qtquick-particles-system-system-qrc.html
                      • qtquick-positioners-example.html
                      • qtquick-positioners-main-cpp.html
                      • qtquick-positioners-positioners-attachedproperties-qml.html
                      • qtquick-positioners-positioners-pro.html
                      • qtquick-positioners-positioners-qml.html
                      • qtquick-positioners-positioners-qmlproject.html
                      • qtquick-positioners-positioners-qrc.html
                      • qtquick-positioners-positioners-transitions-qml.html
                      • qtquick-positioning-anchors.html
                      • qtquick-positioning-layouts.html
                      • qtquick-positioning-righttoleft.html
                      • qtquick-positioning-topic.html
                      • qtquick-qmlmodule.html
                      • qtquick-quick-accessibility-accessibility-qml.html
                      • qtquick-quick-accessibility-accessibility-qmlproject.html
                      • qtquick-quick-accessibility-accessibility-qrc.html
                      • qtquick-quick-accessibility-content-button-qml.html
                      • qtquick-quick-accessibility-content-checkbox-qml.html
                      • qtquick-quick-accessibility-content-slider-qml.html
                      • qtquick-quick-accessibility-example.html
                      • qtquick-quick-accessibility-main-cpp.html
                      • qtquick-quick-accessibility-quick-accessibility-pro.html
                      • qtquick-quickwidgets-quickwidget-example.html
                      • qtquick-quickwidgets-quickwidget-main-cpp.html
                      • qtquick-quickwidgets-quickwidget-quickwidget-pro.html
                      • qtquick-quickwidgets-quickwidget-quickwidget-qrc.html
                      • qtquick-quickwidgets-quickwidget-rotatingsquare-qml.html
                      • qtquick-rendercontrol-cuberenderer-cpp.html
                      • qtquick-rendercontrol-cuberenderer-h.html
                      • qtquick-rendercontrol-demo-qml.html
                      • qtquick-rendercontrol-example.html
                      • qtquick-rendercontrol-main-cpp.html
                      • qtquick-rendercontrol-rendercontrol-pro.html
                      • qtquick-rendercontrol-rendercontrol-qrc.html
                      • qtquick-rendercontrol-window-multithreaded-cpp.html
                      • qtquick-rendercontrol-window-multithreaded-h.html
                      • qtquick-rendercontrol-window-singlethreaded-cpp.html
                      • qtquick-rendercontrol-window-singlethreaded-h.html
                      • qtquick-righttoleft-example.html
                      • qtquick-righttoleft-layoutdirection-layoutdirection-qml.html
                      • qtquick-righttoleft-layoutdirection-layoutdirection-qmlproject.html
                      • qtquick-righttoleft-layoutmirroring-layoutmirroring-qml.html
                      • qtquick-righttoleft-layoutmirroring-layoutmirroring-qmlproject.html
                      • qtquick-righttoleft-main-cpp.html
                      • qtquick-righttoleft-righttoleft-pro.html
                      • qtquick-righttoleft-righttoleft-qml.html
                      • qtquick-righttoleft-righttoleft-qmlproject.html
                      • qtquick-righttoleft-righttoleft-qrc.html
                      • qtquick-righttoleft-textalignment-textalignment-qml.html
                      • qtquick-righttoleft-textalignment-textalignment-qmlproject.html
                      • qtquick-scenegraph-customgeometry-beziercurve-cpp.html
                      • qtquick-scenegraph-customgeometry-beziercurve-h.html
                      • qtquick-scenegraph-customgeometry-customgeometry-pro.html
                      • qtquick-scenegraph-customgeometry-customgeometry-qrc.html
                      • qtquick-scenegraph-customgeometry-example.html
                      • qtquick-scenegraph-customgeometry-main-cpp.html
                      • qtquick-scenegraph-customgeometry-main-qml.html
                      • qtquick-scenegraph-graph-example.html
                      • qtquick-scenegraph-graph-graph-cpp.html
                      • qtquick-scenegraph-graph-graph-h.html
                      • qtquick-scenegraph-graph-graph-pro.html
                      • qtquick-scenegraph-graph-graph-qrc.html
                      • qtquick-scenegraph-graph-gridnode-cpp.html
                      • qtquick-scenegraph-graph-gridnode-h.html
                      • qtquick-scenegraph-graph-linenode-cpp.html
                      • qtquick-scenegraph-graph-linenode-h.html
                      • qtquick-scenegraph-graph-main-cpp.html
                      • qtquick-scenegraph-graph-main-qml.html
                      • qtquick-scenegraph-graph-noisynode-cpp.html
                      • qtquick-scenegraph-graph-noisynode-h.html
                      • qtquick-scenegraph-materials.html
                      • qtquick-scenegraph-nodes.html
                      • qtquick-scenegraph-openglunderqml-example.html
                      • qtquick-scenegraph-openglunderqml-main-cpp.html
                      • qtquick-scenegraph-openglunderqml-main-qml.html
                      • qtquick-scenegraph-openglunderqml-openglunderqml-pro.html
                      • qtquick-scenegraph-openglunderqml-openglunderqml-qrc.html
                      • qtquick-scenegraph-openglunderqml-squircle-cpp.html
                      • qtquick-scenegraph-openglunderqml-squircle-h.html
                      • qtquick-scenegraph-simplematerial-example.html
                      • qtquick-scenegraph-simplematerial-main-qml.html
                      • qtquick-scenegraph-simplematerial-simplematerial-cpp.html
                      • qtquick-scenegraph-simplematerial-simplematerial-pro.html
                      • qtquick-scenegraph-simplematerial-simplematerial-qrc.html
                      • qtquick-scenegraph-textureinsgnode-example.html
                      • qtquick-scenegraph-textureinsgnode-fboinsgrenderer-cpp.html
                      • qtquick-scenegraph-textureinsgnode-fboinsgrenderer-h.html
                      • qtquick-scenegraph-textureinsgnode-main-cpp.html
                      • qtquick-scenegraph-textureinsgnode-main-qml.html
                      • qtquick-scenegraph-textureinsgnode-textureinsgnode-pro.html
                      • qtquick-scenegraph-textureinsgnode-textureinsgnode-qrc.html
                      • qtquick-scenegraph-textureinthread-error-qml.html
                      • qtquick-scenegraph-textureinthread-example.html
                      • qtquick-scenegraph-textureinthread-main-cpp.html
                      • qtquick-scenegraph-textureinthread-main-qml.html
                      • qtquick-scenegraph-textureinthread-textureinthread-pro.html
                      • qtquick-scenegraph-textureinthread-textureinthread-qrc.html
                      • qtquick-scenegraph-textureinthread-threadrenderer-cpp.html
                      • qtquick-scenegraph-textureinthread-threadrenderer-h.html
                      • qtquick-scenegraph-twotextureproviders-example.html
                      • qtquick-scenegraph-twotextureproviders-main-cpp.html
                      • qtquick-scenegraph-twotextureproviders-main-qml.html
                      • qtquick-scenegraph-twotextureproviders-twotextureproviders-pro.html
                      • qtquick-scenegraph-twotextureproviders-twotextureproviders-qrc.html
                      • qtquick-scenegraph-twotextureproviders-xorblender-cpp.html
                      • qtquick-scenegraph-twotextureproviders-xorblender-h.html
                      • qtquick-shadereffects-content-slider-qml.html
                      • qtquick-shadereffects-example.html
                      • qtquick-shadereffects-main-cpp.html
                      • qtquick-shadereffects-shadereffects-pro.html
                      • qtquick-shadereffects-shadereffects-qml.html
                      • qtquick-shadereffects-shadereffects-qmlproject.html
                      • qtquick-shadereffects-shadereffects-qrc.html
                      • qtquick-statesanimations-animations.html
                      • qtquick-statesanimations-behaviors.html
                      • qtquick-statesanimations-states.html
                      • qtquick-statesanimations-topic.html
                      • qtquick-text-example.html
                      • qtquick-text-fonts-availablefonts-qml.html
                      • qtquick-text-fonts-banner-qml.html
                      • qtquick-text-fonts-fonts-qml.html
                      • qtquick-text-fonts-hello-qml.html
                      • qtquick-text-imgtag-imgtag-qml.html
                      • qtquick-text-imgtag-textwithimage-qml.html
                      • qtquick-text-main-cpp.html
                      • qtquick-text-styledtext-layout-qml.html
                      • qtquick-text-text-pro.html
                      • qtquick-text-text-qml.html
                      • qtquick-text-text-qmlproject.html
                      • qtquick-text-text-qrc.html
                      • qtquick-text-textselection-textselection-qml.html
                      • qtquick-text-validator.html
                      • qtquick-threading-example.html
                      • qtquick-threading-main-cpp.html
                      • qtquick-threading-threadedlistmodel-dataloader-js.html
                      • qtquick-threading-threadedlistmodel-example.html
                      • qtquick-threading-threadedlistmodel-threadedlistmodel-qmlproject.html
                      • qtquick-threading-threadedlistmodel-timedisplay-qml.html
                      • qtquick-threading-threading-pro.html
                      • qtquick-threading-threading-qml.html
                      • qtquick-threading-threading-qmlproject.html
                      • qtquick-threading-threading-qrc.html
                      • qtquick-threading-workerscript-spinner-qml.html
                      • qtquick-threading-workerscript-workerscript-js.html
                      • qtquick-threading-workerscript-workerscript-qml.html
                      • qtquick-threading-workerscript-workerscript-qmlproject.html
                      • qtquick-touchinteraction-example.html
                      • qtquick-touchinteraction-flickable-basic-flickable-qml.html
                      • qtquick-touchinteraction-flickable-content-panel-qml.html
                      • qtquick-touchinteraction-flickable-corkboards-qml.html
                      • qtquick-touchinteraction-main-cpp.html
                      • qtquick-touchinteraction-multipointtouch-bearwhack-qml.html
                      • qtquick-touchinteraction-multipointtouch-content-augmentedtouchpoint-qml.html
                      • qtquick-touchinteraction-multipointtouch-content-bearwhackparticlesystem-qml.html
                      • qtquick-touchinteraction-multipointtouch-content-particleflame-qml.html
                      • qtquick-touchinteraction-multipointtouch-multiflame-qml.html
                      • qtquick-touchinteraction-pincharea-flickresize-qml.html
                      • qtquick-touchinteraction-touchinteraction-pro.html
                      • qtquick-touchinteraction-touchinteraction-qml.html
                      • qtquick-touchinteraction-touchinteraction-qmlproject.html
                      • qtquick-touchinteraction-touchinteraction-qrc.html
                      • qtquick-tutorials-dynamicview-dynamicview1-dynamicview-qml.html
                      • qtquick-tutorials-dynamicview-dynamicview1-dynamicview1-qmlproject.html
                      • qtquick-tutorials-dynamicview-dynamicview1-example.html
                      • qtquick-tutorials-dynamicview-dynamicview1-petsmodel-qml.html
                      • qtquick-tutorials-dynamicview-dynamicview2-dynamicview-qml.html
                      • qtquick-tutorials-dynamicview-dynamicview2-dynamicview2-qmlproject.html
                      • qtquick-tutorials-dynamicview-dynamicview2-example.html
                      • qtquick-tutorials-dynamicview-dynamicview2-petsmodel-qml.html
                      • qtquick-tutorials-dynamicview-dynamicview3-dynamicview-qml.html
                      • qtquick-tutorials-dynamicview-dynamicview3-dynamicview3-qmlproject.html
                      • qtquick-tutorials-dynamicview-dynamicview3-example.html
                      • qtquick-tutorials-dynamicview-dynamicview3-petsmodel-qml.html
                      • qtquick-tutorials-dynamicview-dynamicview4-dynamicview-qml.html
                      • qtquick-tutorials-dynamicview-dynamicview4-dynamicview4-qmlproject.html
                      • qtquick-tutorials-dynamicview-dynamicview4-example.html
                      • qtquick-tutorials-dynamicview-dynamicview4-listselector-qml.html
                      • qtquick-tutorials-dynamicview-dynamicview4-petsmodel-qml.html
                      • qtquick-tutorials-samegame-samegame1-block-qml.html
                      • qtquick-tutorials-samegame-samegame1-button-qml.html
                      • qtquick-tutorials-samegame-samegame1-example.html
                      • qtquick-tutorials-samegame-samegame1-samegame-qml.html
                      • qtquick-tutorials-samegame-samegame1-samegame1-qmlproject.html
                      • qtquick-tutorials-samegame-samegame2-block-qml.html
                      • qtquick-tutorials-samegame-samegame2-button-qml.html
                      • qtquick-tutorials-samegame-samegame2-example.html
                      • qtquick-tutorials-samegame-samegame2-samegame-js.html
                      • qtquick-tutorials-samegame-samegame2-samegame-qml.html
                      • qtquick-tutorials-samegame-samegame2-samegame2-qmlproject.html
                      • qtquick-tutorials-samegame-samegame3-block-qml.html
                      • qtquick-tutorials-samegame-samegame3-button-qml.html
                      • qtquick-tutorials-samegame-samegame3-dialog-qml.html
                      • qtquick-tutorials-samegame-samegame3-example.html
                      • qtquick-tutorials-samegame-samegame3-samegame-js.html
                      • qtquick-tutorials-samegame-samegame3-samegame-qml.html
                      • qtquick-tutorials-samegame-samegame3-samegame3-qmlproject.html
                      • qtquick-tutorials-samegame-samegame4-content-boomblock-qml.html
                      • qtquick-tutorials-samegame-samegame4-content-button-qml.html
                      • qtquick-tutorials-samegame-samegame4-content-dialog-qml.html
                      • qtquick-tutorials-samegame-samegame4-content-samegame-js.html
                      • qtquick-tutorials-samegame-samegame4-example.html
                      • qtquick-tutorials-samegame-samegame4-highscores-score-data-xml.html
                      • qtquick-tutorials-samegame-samegame4-samegame-qml.html
                      • qtquick-tutorials-samegame-samegame4-samegame4-qmlproject.html
                      • qtquick-views-example.html
                      • qtquick-views-gridview-gridview-example-qml.html
                      • qtquick-views-listview-content-petsmodel-qml.html
                      • qtquick-views-listview-content-pressandholdbutton-qml.html
                      • qtquick-views-listview-content-recipesmodel-qml.html
                      • qtquick-views-listview-content-smalltext-qml.html
                      • qtquick-views-listview-content-textbutton-qml.html
                      • qtquick-views-listview-content-togglebutton-qml.html
                      • qtquick-views-listview-displaymargin-qml.html
                      • qtquick-views-listview-dynamiclist-qml.html
                      • qtquick-views-listview-expandingdelegates-qml.html
                      • qtquick-views-listview-highlight-qml.html
                      • qtquick-views-listview-highlightranges-qml.html
                      • qtquick-views-listview-sections-qml.html
                      • qtquick-views-main-cpp.html
                      • qtquick-views-objectmodel-objectmodel-qml.html
                      • qtquick-views-package-delegate-qml.html
                      • qtquick-views-package-view-qml.html
                      • qtquick-views-parallax-content-clock-qml.html
                      • qtquick-views-parallax-content-parallaxview-qml.html
                      • qtquick-views-parallax-content-pics-home-page-svg.html
                      • qtquick-views-parallax-content-quitbutton-qml.html
                      • qtquick-views-parallax-content-smiley-qml.html
                      • qtquick-views-parallax-parallax-qml.html
                      • qtquick-views-pathview-pathview-example-qml.html
                      • qtquick-views-views-pro.html
                      • qtquick-views-views-qml.html
                      • qtquick-views-views-qmlproject.html
                      • qtquick-views-views-qrc.html
                      • qtquick-views-visualdatamodel-dragselection-qml.html
                      • qtquick-views-visualdatamodel-slideshow-qml.html
                      • qtquick-views-visualdatamodel-visualdatamodel-qmlproject.html
                      • qtquick-visualcanvas-coordinates.html
                      • qtquick-visualcanvas-scenegraph-renderer.html
                      • qtquick-visualcanvas-scenegraph.html
                      • qtquick-visualcanvas-topic.html
                      • qtquick-visualcanvas-visualparent.html
                      • qtquick-visualtypes-topic.html
                      • qtquick-window-example.html
                      • qtquick-window-main-cpp.html
                      • qtquick-window-qmlmodule.html
                      • qtquick-window-resources-icon-svg.html
                      • qtquick-window-screeninfo-qml.html
                      • qtquick-window-splash-qml.html
                      • qtquick-window-window-pro.html
                      • qtquick-window-window-qml.html
                      • qtquick-window-window-qrc.html
                      • qtquick-xmllistmodel-qmlmodule.html
                      • qtquick.index
                      • qtquick.qhp
                      • qtquick.qhp.sha1
                      • qtquick.tags
                      • qtquicklayouts-index.html
                      • qtquicklayouts-overview.html
                      • qtquickwidgets-module.html
                      • qttest-qmlmodule.html
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtquickcontrols.qch
                    • qtquickcontrols
                      • applicationwindow.html
                      • controls.html
                      • controlsstyling.html
                      • examples-manifest.xml
                      • images
                        • applicationwindow.png
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • busyindicator.png
                        • button.png
                        • calendar.png
                        • calendarstyle-components-week-numbers.png
                        • checkbox.png
                        • circulargauge-angles.png
                        • circulargauge-needle-example-2.png
                        • circulargauge-needle.png
                        • circulargauge-reversed.png
                        • circulargauge-tickmark-indices-values.png
                        • combobox.png
                        • gauge-minorTickmark-example.png
                        • gauge-temperature.png
                        • gauge-tickmark-example.png
                        • groupbox.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • label.png
                        • logo.png
                        • menu.png
                        • menubar-action.png
                        • menubar.png
                        • piemenu-menuitem-example.png
                        • progressbar.png
                        • qtquickcontrols-example-calendar.png
                        • qtquickcontrols-example-filesystembrowser.png
                        • qtquickcontrols-example-gallery-android-dark.png
                        • qtquickcontrols-example-gallery-android.png
                        • qtquickcontrols-example-gallery-osx.png
                        • qtquickcontrols-example-styles.png
                        • qtquickcontrols-example-tableview.png
                        • qtquickcontrols-example-text.png
                        • qtquickcontrols-example-touch.png
                        • qtquickcontrols-example-uiforms.png
                        • radiobutton.png
                        • scrollview.png
                        • slider.png
                        • spinbox.png
                        • splitview.png
                        • square-blue.png
                        • square-green.png
                        • square-red.png
                        • square-white.png
                        • square-yellow.png
                        • stackview.png
                        • styling-circulargauge-background-example.png
                        • styling-circulargauge-knob-example.png
                        • styling-circulargauge-minorTickmark-example.png
                        • styling-circulargauge-needle-example.png
                        • styling-circulargauge-tickmark-example.png
                        • styling-circulargauge-tickmarkLabel-example.png
                        • styling-gauge-font-size.png
                        • styling-gauge-foreground.png
                        • styling-gauge-minorTickmark.png
                        • styling-gauge-tickmark.png
                        • styling-gauge-valueBar.png
                        • switch.png
                        • tableview.png
                        • tabview.png
                        • textarea.png
                        • textfield.png
                        • toolbar.png
                        • treeview.png
                        • tumbler-flat-style.png
                        • tumbler.png
                        • used-in-examples
                          • calendar
                            • images
                              • eventindicator.png
                          • styles
                            • images
                              • bubble.png
                              • button-pressed.png
                              • button.png
                              • progress-background.png
                              • progress-fill.png
                              • slider-handle.png
                              • tab.png
                              • tab_selected.png
                              • textfield.png
                          • touch
                            • images
                              • button_default.png
                              • button_pressed.png
                              • navigation_next_item.png
                              • navigation_previous_item.png
                              • tabs_standard.png
                              • tab_selected.png
                              • textinput.png
                              • toolbar.png
                      • menus.html
                      • qml-qtquick-controls-action-members.html
                      • qml-qtquick-controls-action.html
                      • qml-qtquick-controls-applicationwindow-members.html
                      • qml-qtquick-controls-applicationwindow.html
                      • qml-qtquick-controls-busyindicator-members.html
                      • qml-qtquick-controls-busyindicator.html
                      • qml-qtquick-controls-button-members.html
                      • qml-qtquick-controls-button.html
                      • qml-qtquick-controls-calendar-members.html
                      • qml-qtquick-controls-calendar.html
                      • qml-qtquick-controls-checkbox-members.html
                      • qml-qtquick-controls-checkbox.html
                      • qml-qtquick-controls-combobox-members.html
                      • qml-qtquick-controls-combobox.html
                      • qml-qtquick-controls-exclusivegroup-members.html
                      • qml-qtquick-controls-exclusivegroup.html
                      • qml-qtquick-controls-groupbox-members.html
                      • qml-qtquick-controls-groupbox.html
                      • qml-qtquick-controls-label-members.html
                      • qml-qtquick-controls-label.html
                      • qml-qtquick-controls-menu-members.html
                      • qml-qtquick-controls-menu.html
                      • qml-qtquick-controls-menubar-members.html
                      • qml-qtquick-controls-menubar.html
                      • qml-qtquick-controls-menuitem-members.html
                      • qml-qtquick-controls-menuitem.html
                      • qml-qtquick-controls-menuseparator-members.html
                      • qml-qtquick-controls-menuseparator.html
                      • qml-qtquick-controls-progressbar-members.html
                      • qml-qtquick-controls-progressbar.html
                      • qml-qtquick-controls-radiobutton-members.html
                      • qml-qtquick-controls-radiobutton.html
                      • qml-qtquick-controls-scrollview-members.html
                      • qml-qtquick-controls-scrollview.html
                      • qml-qtquick-controls-slider-members.html
                      • qml-qtquick-controls-slider.html
                      • qml-qtquick-controls-spinbox-members.html
                      • qml-qtquick-controls-spinbox.html
                      • qml-qtquick-controls-splitview-members.html
                      • qml-qtquick-controls-splitview.html
                      • qml-qtquick-controls-stack-members.html
                      • qml-qtquick-controls-stack.html
                      • qml-qtquick-controls-stackview-members.html
                      • qml-qtquick-controls-stackview-obsolete.html
                      • qml-qtquick-controls-stackview.html
                      • qml-qtquick-controls-stackviewdelegate-members.html
                      • qml-qtquick-controls-stackviewdelegate.html
                      • qml-qtquick-controls-statusbar-members.html
                      • qml-qtquick-controls-statusbar.html
                      • qml-qtquick-controls-styles-applicationwindowstyle-members.html
                      • qml-qtquick-controls-styles-applicationwindowstyle.html
                      • qml-qtquick-controls-styles-busyindicatorstyle-members.html
                      • qml-qtquick-controls-styles-busyindicatorstyle.html
                      • qml-qtquick-controls-styles-buttonstyle-members.html
                      • qml-qtquick-controls-styles-buttonstyle.html
                      • qml-qtquick-controls-styles-calendarstyle-members.html
                      • qml-qtquick-controls-styles-calendarstyle.html
                      • qml-qtquick-controls-styles-checkboxstyle-members.html
                      • qml-qtquick-controls-styles-checkboxstyle.html
                      • qml-qtquick-controls-styles-circulargaugestyle-members.html
                      • qml-qtquick-controls-styles-circulargaugestyle.html
                      • qml-qtquick-controls-styles-comboboxstyle-members.html
                      • qml-qtquick-controls-styles-comboboxstyle.html
                      • qml-qtquick-controls-styles-delaybuttonstyle-members.html
                      • qml-qtquick-controls-styles-delaybuttonstyle.html
                      • qml-qtquick-controls-styles-dialstyle-members.html
                      • qml-qtquick-controls-styles-dialstyle.html
                      • qml-qtquick-controls-styles-gaugestyle-members.html
                      • qml-qtquick-controls-styles-gaugestyle.html
                      • qml-qtquick-controls-styles-menubarstyle-members.html
                      • qml-qtquick-controls-styles-menubarstyle.html
                      • qml-qtquick-controls-styles-menustyle-members.html
                      • qml-qtquick-controls-styles-menustyle.html
                      • qml-qtquick-controls-styles-piemenustyle-members.html
                      • qml-qtquick-controls-styles-piemenustyle.html
                      • qml-qtquick-controls-styles-progressbarstyle-members.html
                      • qml-qtquick-controls-styles-progressbarstyle.html
                      • qml-qtquick-controls-styles-radiobuttonstyle-members.html
                      • qml-qtquick-controls-styles-radiobuttonstyle.html
                      • qml-qtquick-controls-styles-scrollviewstyle-members.html
                      • qml-qtquick-controls-styles-scrollviewstyle.html
                      • qml-qtquick-controls-styles-sliderstyle-members.html
                      • qml-qtquick-controls-styles-sliderstyle.html
                      • qml-qtquick-controls-styles-spinboxstyle-members.html
                      • qml-qtquick-controls-styles-spinboxstyle.html
                      • qml-qtquick-controls-styles-statusbarstyle-members.html
                      • qml-qtquick-controls-styles-statusbarstyle.html
                      • qml-qtquick-controls-styles-statusindicatorstyle-members.html
                      • qml-qtquick-controls-styles-statusindicatorstyle.html
                      • qml-qtquick-controls-styles-switchstyle-members.html
                      • qml-qtquick-controls-styles-switchstyle.html
                      • qml-qtquick-controls-styles-tableviewstyle-members.html
                      • qml-qtquick-controls-styles-tableviewstyle.html
                      • qml-qtquick-controls-styles-tabviewstyle-members.html
                      • qml-qtquick-controls-styles-tabviewstyle.html
                      • qml-qtquick-controls-styles-textareastyle-members.html
                      • qml-qtquick-controls-styles-textareastyle.html
                      • qml-qtquick-controls-styles-textfieldstyle-members.html
                      • qml-qtquick-controls-styles-textfieldstyle.html
                      • qml-qtquick-controls-styles-togglebuttonstyle-members.html
                      • qml-qtquick-controls-styles-togglebuttonstyle.html
                      • qml-qtquick-controls-styles-toolbarstyle-members.html
                      • qml-qtquick-controls-styles-toolbarstyle.html
                      • qml-qtquick-controls-styles-treeviewstyle-members.html
                      • qml-qtquick-controls-styles-treeviewstyle.html
                      • qml-qtquick-controls-styles-tumblerstyle-members.html
                      • qml-qtquick-controls-styles-tumblerstyle.html
                      • qml-qtquick-controls-switch-members.html
                      • qml-qtquick-controls-switch.html
                      • qml-qtquick-controls-tab-members.html
                      • qml-qtquick-controls-tab.html
                      • qml-qtquick-controls-tableview-members.html
                      • qml-qtquick-controls-tableview.html
                      • qml-qtquick-controls-tableviewcolumn-members.html
                      • qml-qtquick-controls-tableviewcolumn.html
                      • qml-qtquick-controls-tabview-members.html
                      • qml-qtquick-controls-tabview.html
                      • qml-qtquick-controls-textarea-members.html
                      • qml-qtquick-controls-textarea.html
                      • qml-qtquick-controls-textfield-members.html
                      • qml-qtquick-controls-textfield.html
                      • qml-qtquick-controls-toolbar-members.html
                      • qml-qtquick-controls-toolbar.html
                      • qml-qtquick-controls-toolbutton-members.html
                      • qml-qtquick-controls-toolbutton.html
                      • qml-qtquick-controls-treeview-members.html
                      • qml-qtquick-controls-treeview.html
                      • qtquick-controls-qmlmodule.html
                      • qtquick-controls-styles-qmlmodule.html
                      • qtquickcontrols-calendar-calendar-pro.html
                      • qtquickcontrols-calendar-example.html
                      • qtquickcontrols-calendar-qml-main-qml.html
                      • qtquickcontrols-calendar-resources-qrc.html
                      • qtquickcontrols-calendar-src-event-cpp.html
                      • qtquickcontrols-calendar-src-event-h.html
                      • qtquickcontrols-calendar-src-main-cpp.html
                      • qtquickcontrols-calendar-src-sqleventmodel-cpp.html
                      • qtquickcontrols-calendar-src-sqleventmodel-h.html
                      • qtquickcontrols-examples.html
                      • qtquickcontrols-filesystembrowser-example.html
                      • qtquickcontrols-filesystembrowser-filesystembrowser-pro.html
                      • qtquickcontrols-filesystembrowser-main-cpp.html
                      • qtquickcontrols-filesystembrowser-main-qml.html
                      • qtquickcontrols-filesystembrowser-qml-qrc.html
                      • qtquickcontrols-gallery-example.html
                      • qtquickcontrols-gallery-gallery-pro.html
                      • qtquickcontrols-gallery-gallery-qrc.html
                      • qtquickcontrols-gallery-main-cpp.html
                      • qtquickcontrols-gallery-main-qml.html
                      • qtquickcontrols-gallery-qml-android-ui-js.html
                      • qtquickcontrols-gallery-qml-buttonpage-qml.html
                      • qtquickcontrols-gallery-qml-inputpage-qml.html
                      • qtquickcontrols-gallery-qml-ios-ui-js.html
                      • qtquickcontrols-gallery-qml-osx-ui-js.html
                      • qtquickcontrols-gallery-qml-progresspage-qml.html
                      • qtquickcontrols-gallery-qml-ui-js.html
                      • qtquickcontrols-index.html
                      • qtquickcontrols-overview.html
                      • qtquickcontrols-platformnotes.html
                      • qtquickcontrols-styles-example.html
                      • qtquickcontrols-styles-main-cpp.html
                      • qtquickcontrols-styles-main-qml.html
                      • qtquickcontrols-styles-styles-pro.html
                      • qtquickcontrols-styles-styles-qrc.html
                      • qtquickcontrols-tableview-example.html
                      • qtquickcontrols-tableview-main-qml.html
                      • qtquickcontrols-tableview-src-main-cpp.html
                      • qtquickcontrols-tableview-src-sortfilterproxymodel-cpp.html
                      • qtquickcontrols-tableview-src-sortfilterproxymodel-h.html
                      • qtquickcontrols-tableview-tableview-pro.html
                      • qtquickcontrols-tableview-tableview-qrc.html
                      • qtquickcontrols-texteditor-example.html
                      • qtquickcontrols-texteditor-qml-main-qml.html
                      • qtquickcontrols-texteditor-qml-toolbarseparator-qml.html
                      • qtquickcontrols-texteditor-resources-qrc.html
                      • qtquickcontrols-texteditor-src-documenthandler-cpp.html
                      • qtquickcontrols-texteditor-src-documenthandler-h.html
                      • qtquickcontrols-texteditor-src-main-cpp.html
                      • qtquickcontrols-texteditor-texteditor-pro.html
                      • qtquickcontrols-touch-content-androiddelegate-qml.html
                      • qtquickcontrols-touch-content-buttonpage-qml.html
                      • qtquickcontrols-touch-content-listpage-qml.html
                      • qtquickcontrols-touch-content-progressbarpage-qml.html
                      • qtquickcontrols-touch-content-sliderpage-qml.html
                      • qtquickcontrols-touch-content-tabbarpage-qml.html
                      • qtquickcontrols-touch-content-textinputpage-qml.html
                      • qtquickcontrols-touch-example.html
                      • qtquickcontrols-touch-main-qml.html
                      • qtquickcontrols-touch-resources-qrc.html
                      • qtquickcontrols-touch-src-main-cpp.html
                      • qtquickcontrols-touch-touch-pro.html
                      • qtquickcontrols-touch-touch-qmlproject.html
                      • qtquickcontrols-uiforms-example.html
                      • qtquickcontrols-uiforms-main-cpp.html
                      • qtquickcontrols-uiforms-main-qml.html
                      • qtquickcontrols-uiforms-mainform-ui-qml.html
                      • qtquickcontrols-uiforms-qml-customermodel-qml.html
                      • qtquickcontrols-uiforms-qml-history-qml.html
                      • qtquickcontrols-uiforms-qml-historyform-ui-qml.html
                      • qtquickcontrols-uiforms-qml-notes-qml.html
                      • qtquickcontrols-uiforms-qml-notesform-ui-qml.html
                      • qtquickcontrols-uiforms-qml-settings-qml.html
                      • qtquickcontrols-uiforms-qml-settingsform-ui-qml.html
                      • qtquickcontrols-uiforms-uiforms-pro.html
                      • qtquickcontrols-uiforms-uiforms-qrc.html
                      • qtquickcontrols.index
                      • qtquickcontrols.qhp
                      • qtquickcontrols.qhp.sha1
                      • qtquickcontrols.tags
                      • qtquickcontrolsstyles-index.html
                      • style
                        • offline-simple.css
                        • offline.css
                      • styling-circulargauge.html
                      • styling-gauge.html
                      • stylingtutorials.html
                      • views.html
                      • viewsstyling.html
                    • qtquickcontrols2.qch
                    • qtquickcontrols2
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • qtlabscalendar-dayofweekrow-layout.png
                        • qtlabscalendar-dayofweekrow.png
                        • qtlabscalendar-monthgrid-layout.png
                        • qtlabscalendar-monthgrid.png
                        • qtlabscalendar-weeknumbercolumn-layout.png
                        • qtlabscalendar-weeknumbercolumn.png
                        • qtquickcontrols2-applicationwindow-wireframe.png
                        • qtquickcontrols2-busyindicator-custom.png
                        • qtquickcontrols2-busyindicator.gif
                        • qtquickcontrols2-busyindicator.png
                        • qtquickcontrols2-button-custom.png
                        • qtquickcontrols2-button-flat.gif
                        • qtquickcontrols2-button-highlighted.gif
                        • qtquickcontrols2-button.gif
                        • qtquickcontrols2-chattutorial-chapter1.png
                        • qtquickcontrols2-chattutorial-chapter2-listview-header.gif
                        • qtquickcontrols2-chattutorial-chapter2.png
                        • qtquickcontrols2-chattutorial-chapter3-listview-header.gif
                        • qtquickcontrols2-chattutorial-chapter3-view-margins.png
                        • qtquickcontrols2-chattutorial-chapter3.gif
                        • qtquickcontrols2-chattutorial-chapter4-long-message.png
                        • qtquickcontrols2-chattutorial-chapter4-message-timestamp.png
                        • qtquickcontrols2-chattutorial-chapter4.gif
                        • qtquickcontrols2-chattutorial-chapter5-contacts-material-dark.png
                        • qtquickcontrols2-chattutorial-chapter5-contacts-material-test.png
                        • qtquickcontrols2-chattutorial-chapter5-contacts-material.png
                        • qtquickcontrols2-chattutorial-chapter5-contacts-universal-dark.png
                        • qtquickcontrols2-chattutorial-chapter5-contacts-universal.png
                        • qtquickcontrols2-chattutorial-chapter5-conversations-material-dark.png
                        • qtquickcontrols2-chattutorial-chapter5-conversations-material-test.png
                        • qtquickcontrols2-chattutorial-chapter5-conversations-material.png
                        • qtquickcontrols2-chattutorial-chapter5-conversations-universal-dark.png
                        • qtquickcontrols2-chattutorial-chapter5-conversations-universal.png
                        • qtquickcontrols2-checkbox-custom.png
                        • qtquickcontrols2-checkbox-tristate.gif
                        • qtquickcontrols2-checkbox.gif
                        • qtquickcontrols2-checkbox.png
                        • qtquickcontrols2-checkdelegate-custom.png
                        • qtquickcontrols2-checkdelegate.gif
                        • qtquickcontrols2-combobox-custom.png
                        • qtquickcontrols2-combobox.png
                        • qtquickcontrols2-control.png
                        • qtquickcontrols2-customize-buttons.png
                        • qtquickcontrols2-default.png
                        • qtquickcontrols2-dial-custom.png
                        • qtquickcontrols2-dial-no-wrap.gif
                        • qtquickcontrols2-dial-wrap.gif
                        • qtquickcontrols2-dial.png
                        • qtquickcontrols2-drawer-expanded-wireframe.png
                        • qtquickcontrols2-drawer-wireframe.png
                        • qtquickcontrols2-frame-custom.png
                        • qtquickcontrols2-frame.png
                        • qtquickcontrols2-gallery-drawer.png
                        • qtquickcontrols2-gallery-menu.png
                        • qtquickcontrols2-gallery-welcome.png
                        • qtquickcontrols2-groupbox-checkable.png
                        • qtquickcontrols2-groupbox-custom.png
                        • qtquickcontrols2-groupbox.png
                        • qtquickcontrols2-itemdelegate-custom.png
                        • qtquickcontrols2-itemdelegate.gif
                        • qtquickcontrols2-label-custom.png
                        • qtquickcontrols2-label.png
                        • qtquickcontrols2-material-attributes.png
                        • qtquickcontrols2-material-button.png
                        • qtquickcontrols2-material-dark.png
                        • qtquickcontrols2-material.png
                        • qtquickcontrols2-menu.png
                        • qtquickcontrols2-page-wireframe.png
                        • qtquickcontrols2-pageindicator-custom.png
                        • qtquickcontrols2-pageindicator.png
                        • qtquickcontrols2-pane-custom.png
                        • qtquickcontrols2-pane.png
                        • qtquickcontrols2-popup-custom.png
                        • qtquickcontrols2-popup-settings.png
                        • qtquickcontrols2-popup-transformorigin.png
                        • qtquickcontrols2-progressbar-custom.png
                        • qtquickcontrols2-progressbar-disabled.png
                        • qtquickcontrols2-progressbar-indeterminate.png
                        • qtquickcontrols2-progressbar-normal.png
                        • qtquickcontrols2-radiobutton-checked.png
                        • qtquickcontrols2-radiobutton-custom.png
                        • qtquickcontrols2-radiobutton-disabled.png
                        • qtquickcontrols2-radiobutton-focused.png
                        • qtquickcontrols2-radiobutton-normal.png
                        • qtquickcontrols2-radiobutton.png
                        • qtquickcontrols2-radiodelegate-custom.png
                        • qtquickcontrols2-radiodelegate.gif
                        • qtquickcontrols2-rangeslider-custom.png
                        • qtquickcontrols2-rangeslider.gif
                        • qtquickcontrols2-scrollbar-custom.png
                        • qtquickcontrols2-scrollbar.gif
                        • qtquickcontrols2-scrollindicator-custom.png
                        • qtquickcontrols2-scrollindicator.png
                        • qtquickcontrols2-slider-custom.png
                        • qtquickcontrols2-slider-disabled.png
                        • qtquickcontrols2-slider-focused.png
                        • qtquickcontrols2-slider-normal.png
                        • qtquickcontrols2-slider.gif
                        • qtquickcontrols2-slider.png
                        • qtquickcontrols2-spinbox-custom.png
                        • qtquickcontrols2-spinbox-double.png
                        • qtquickcontrols2-spinbox-textual.png
                        • qtquickcontrols2-spinbox.png
                        • qtquickcontrols2-stackview-wireframe.png
                        • qtquickcontrols2-swipedelegate-behind.gif
                        • qtquickcontrols2-swipedelegate-custom.png
                        • qtquickcontrols2-swipedelegate-leading-trailing.gif
                        • qtquickcontrols2-swipedelegate.gif
                        • qtquickcontrols2-swipeview-wireframe.png
                        • qtquickcontrols2-switch-checked.png
                        • qtquickcontrols2-switch-custom.png
                        • qtquickcontrols2-switch-disabled.png
                        • qtquickcontrols2-switch-focused.png
                        • qtquickcontrols2-switch-normal.png
                        • qtquickcontrols2-switch.gif
                        • qtquickcontrols2-switch.png
                        • qtquickcontrols2-switchdelegate-custom.png
                        • qtquickcontrols2-switchdelegate.gif
                        • qtquickcontrols2-tabbar-custom.png
                        • qtquickcontrols2-tabbar-explicit.png
                        • qtquickcontrols2-tabbar-flickable.png
                        • qtquickcontrols2-tabbar-wireframe.png
                        • qtquickcontrols2-tabbutton.png
                        • qtquickcontrols2-textarea-custom.png
                        • qtquickcontrols2-textarea-flickable.png
                        • qtquickcontrols2-textarea.png
                        • qtquickcontrols2-textfield-custom.png
                        • qtquickcontrols2-textfield-disabled.png
                        • qtquickcontrols2-textfield-focused.png
                        • qtquickcontrols2-textfield-normal.png
                        • qtquickcontrols2-textfield.png
                        • qtquickcontrols2-toolbar-custom.png
                        • qtquickcontrols2-toolbar.png
                        • qtquickcontrols2-toolbutton-custom.png
                        • qtquickcontrols2-toolbutton.png
                        • qtquickcontrols2-tooltip-slider.png
                        • qtquickcontrols2-tooltip.png
                        • qtquickcontrols2-tumbler-custom.png
                        • qtquickcontrols2-tumbler-wrap.gif
                        • qtquickcontrols2-tumbler.png
                        • qtquickcontrols2-universal-attributes.png
                        • qtquickcontrols2-universal-button.png
                        • qtquickcontrols2-universal-dark.png
                        • qtquickcontrols2-universal.png
                        • used-in-examples
                          • gallery
                            • images
                              • +material
                                • back.png
                                • back@2x.png
                                • back@3x.png
                                • back@4x.png
                                • drawer.png
                                • drawer@2x.png
                                • drawer@3x.png
                                • drawer@4x.png
                                • menu.png
                                • menu@2x.png
                                • menu@3x.png
                                • menu@4x.png
                              • arrow.png
                              • arrow@2x.png
                              • arrow@3x.png
                              • arrow@4x.png
                              • arrows.png
                              • arrows@2x.png
                              • arrows@3x.png
                              • arrows@4x.png
                              • back.png
                              • back@2x.png
                              • back@3x.png
                              • back@4x.png
                              • drawer.png
                              • drawer@2x.png
                              • drawer@3x.png
                              • drawer@4x.png
                              • menu.png
                              • menu@2x.png
                              • menu@3x.png
                              • menu@4x.png
                              • qt-logo.png
                              • qt-logo@2x.png
                              • qt-logo@3x.png
                              • qt-logo@4x.png
                      • qml-qt-labs-calendar2-calendar-members.html
                      • qml-qt-labs-calendar2-calendar.html
                      • qml-qt-labs-calendar2-calendarmodel-members.html
                      • qml-qt-labs-calendar2-calendarmodel.html
                      • qml-qt-labs-calendar2-dayofweekrow-members.html
                      • qml-qt-labs-calendar2-dayofweekrow.html
                      • qml-qt-labs-calendar2-monthgrid-members.html
                      • qml-qt-labs-calendar2-monthgrid.html
                      • qml-qt-labs-calendar2-weeknumbercolumn-members.html
                      • qml-qt-labs-calendar2-weeknumbercolumn.html
                      • qml-qtquick-controls2-abstractbutton-members.html
                      • qml-qtquick-controls2-abstractbutton.html
                      • qml-qtquick-controls2-applicationwindow-members.html
                      • qml-qtquick-controls2-applicationwindow.html
                      • qml-qtquick-controls2-busyindicator-members.html
                      • qml-qtquick-controls2-busyindicator.html
                      • qml-qtquick-controls2-button-members.html
                      • qml-qtquick-controls2-button.html
                      • qml-qtquick-controls2-buttongroup-members.html
                      • qml-qtquick-controls2-buttongroup.html
                      • qml-qtquick-controls2-checkbox-members.html
                      • qml-qtquick-controls2-checkbox.html
                      • qml-qtquick-controls2-checkdelegate-members.html
                      • qml-qtquick-controls2-checkdelegate.html
                      • qml-qtquick-controls2-combobox-members.html
                      • qml-qtquick-controls2-combobox.html
                      • qml-qtquick-controls2-container-members.html
                      • qml-qtquick-controls2-container.html
                      • qml-qtquick-controls2-control-members.html
                      • qml-qtquick-controls2-control.html
                      • qml-qtquick-controls2-dial-members.html
                      • qml-qtquick-controls2-dial.html
                      • qml-qtquick-controls2-drawer-members.html
                      • qml-qtquick-controls2-drawer.html
                      • qml-qtquick-controls2-frame-members.html
                      • qml-qtquick-controls2-frame.html
                      • qml-qtquick-controls2-groupbox-members.html
                      • qml-qtquick-controls2-groupbox.html
                      • qml-qtquick-controls2-itemdelegate-members.html
                      • qml-qtquick-controls2-itemdelegate.html
                      • qml-qtquick-controls2-label-members.html
                      • qml-qtquick-controls2-label.html
                      • qml-qtquick-controls2-menu-members.html
                      • qml-qtquick-controls2-menu.html
                      • qml-qtquick-controls2-menuitem-members.html
                      • qml-qtquick-controls2-menuitem.html
                      • qml-qtquick-controls2-page-members.html
                      • qml-qtquick-controls2-page.html
                      • qml-qtquick-controls2-pageindicator-members.html
                      • qml-qtquick-controls2-pageindicator.html
                      • qml-qtquick-controls2-pane-members.html
                      • qml-qtquick-controls2-pane.html
                      • qml-qtquick-controls2-popup-members.html
                      • qml-qtquick-controls2-popup.html
                      • qml-qtquick-controls2-progressbar-members.html
                      • qml-qtquick-controls2-progressbar.html
                      • qml-qtquick-controls2-radiobutton-members.html
                      • qml-qtquick-controls2-radiobutton.html
                      • qml-qtquick-controls2-radiodelegate-members.html
                      • qml-qtquick-controls2-radiodelegate.html
                      • qml-qtquick-controls2-rangeslider-members.html
                      • qml-qtquick-controls2-rangeslider.html
                      • qml-qtquick-controls2-scrollbar-members.html
                      • qml-qtquick-controls2-scrollbar.html
                      • qml-qtquick-controls2-scrollindicator-members.html
                      • qml-qtquick-controls2-scrollindicator.html
                      • qml-qtquick-controls2-slider-members.html
                      • qml-qtquick-controls2-slider.html
                      • qml-qtquick-controls2-spinbox-members.html
                      • qml-qtquick-controls2-spinbox.html
                      • qml-qtquick-controls2-stackview-members.html
                      • qml-qtquick-controls2-stackview.html
                      • qml-qtquick-controls2-swipedelegate-members.html
                      • qml-qtquick-controls2-swipedelegate.html
                      • qml-qtquick-controls2-swipeview-members.html
                      • qml-qtquick-controls2-swipeview.html
                      • qml-qtquick-controls2-switch-members.html
                      • qml-qtquick-controls2-switch.html
                      • qml-qtquick-controls2-switchdelegate-members.html
                      • qml-qtquick-controls2-switchdelegate.html
                      • qml-qtquick-controls2-tabbar-members.html
                      • qml-qtquick-controls2-tabbar.html
                      • qml-qtquick-controls2-tabbutton-members.html
                      • qml-qtquick-controls2-tabbutton.html
                      • qml-qtquick-controls2-textarea-members.html
                      • qml-qtquick-controls2-textarea.html
                      • qml-qtquick-controls2-textfield-members.html
                      • qml-qtquick-controls2-textfield.html
                      • qml-qtquick-controls2-toolbar-members.html
                      • qml-qtquick-controls2-toolbar.html
                      • qml-qtquick-controls2-toolbutton-members.html
                      • qml-qtquick-controls2-toolbutton.html
                      • qml-qtquick-controls2-tooltip-members.html
                      • qml-qtquick-controls2-tooltip.html
                      • qml-qtquick-controls2-tumbler-members.html
                      • qml-qtquick-controls2-tumbler.html
                      • qquickstyle-members.html
                      • qquickstyle.html
                      • qt-labs-calendar2-qmlmodule.html
                      • qtlabscalendar-index.html
                      • qtquick-controls2-qmlmodule.html
                      • qtquick-templates2-qmlmodule.html
                      • qtquickcontrols2-buttons.html
                      • qtquickcontrols2-chattutorial-chapter1-settingup-chapter1-settingup-pro.html
                      • qtquickcontrols2-chattutorial-chapter1-settingup-main-cpp.html
                      • qtquickcontrols2-chattutorial-chapter1-settingup-main-qml.html
                      • qtquickcontrols2-chattutorial-chapter1-settingup-qml-qrc.html
                      • qtquickcontrols2-chattutorial-chapter2-lists-chapter2-lists-pro.html
                      • qtquickcontrols2-chattutorial-chapter2-lists-main-qml.html
                      • qtquickcontrols2-chattutorial-chapter2-lists-qml-qrc.html
                      • qtquickcontrols2-chattutorial-chapter3-navigation-chapter3-navigation-pro.html
                      • qtquickcontrols2-chattutorial-chapter3-navigation-contactpage-qml.html
                      • qtquickcontrols2-chattutorial-chapter3-navigation-conversationpage-qml.html
                      • qtquickcontrols2-chattutorial-chapter3-navigation-main-qml.html
                      • qtquickcontrols2-chattutorial-chapter3-navigation-qml-qrc.html
                      • qtquickcontrols2-chattutorial-chapter4-models-chapter4-models-pro.html
                      • qtquickcontrols2-chattutorial-chapter4-models-contactpage-qml.html
                      • qtquickcontrols2-chattutorial-chapter4-models-conversationpage-qml.html
                      • qtquickcontrols2-chattutorial-chapter4-models-main-qml.html
                      • qtquickcontrols2-chattutorial-chapter4-models-qml-qrc.html
                      • qtquickcontrols2-chattutorial-chapter4-models-sqlcontactmodel-cpp.html
                      • qtquickcontrols2-chattutorial-chapter4-models-sqlcontactmodel-h.html
                      • qtquickcontrols2-chattutorial-chapter4-models-sqlconversationmodel-cpp.html
                      • qtquickcontrols2-chattutorial-chapter4-models-sqlconversationmodel-h.html
                      • qtquickcontrols2-chattutorial-chapter5-styling-chapter5-styling-pro.html
                      • qtquickcontrols2-chattutorial-chapter5-styling-chattoolbar-qml.html
                      • qtquickcontrols2-chattutorial-chapter5-styling-contactpage-qml.html
                      • qtquickcontrols2-chattutorial-chapter5-styling-conversationpage-qml.html
                      • qtquickcontrols2-chattutorial-chapter5-styling-main-qml.html
                      • qtquickcontrols2-chattutorial-chapter5-styling-material-chattoolbar-qml.html
                      • qtquickcontrols2-chattutorial-chapter5-styling-qml-qrc.html
                      • qtquickcontrols2-chattutorial-chapter5-styling-sqlcontactmodel-cpp.html
                      • qtquickcontrols2-chattutorial-chapter5-styling-sqlcontactmodel-h.html
                      • qtquickcontrols2-chattutorial-chapter5-styling-sqlconversationmodel-cpp.html
                      • qtquickcontrols2-chattutorial-chapter5-styling-sqlconversationmodel-h.html
                      • qtquickcontrols2-chattutorial-chattutorial-pro.html
                      • qtquickcontrols2-chattutorial-example.html
                      • qtquickcontrols2-chattutorial-shared-shared-qrc.html
                      • qtquickcontrols2-containers.html
                      • qtquickcontrols2-customize.html
                      • qtquickcontrols2-default.html
                      • qtquickcontrols2-delegates.html
                      • qtquickcontrols2-deployment.html
                      • qtquickcontrols2-differences.html
                      • qtquickcontrols2-examples.html
                      • qtquickcontrols2-fileselectors.html
                      • qtquickcontrols2-gallery-example.html
                      • qtquickcontrols2-gallery-gallery-cpp.html
                      • qtquickcontrols2-gallery-gallery-pro.html
                      • qtquickcontrols2-gallery-gallery-qml.html
                      • qtquickcontrols2-gallery-gallery-qrc.html
                      • qtquickcontrols2-gallery-pages-busyindicatorpage-qml.html
                      • qtquickcontrols2-gallery-pages-buttonpage-qml.html
                      • qtquickcontrols2-gallery-pages-checkboxpage-qml.html
                      • qtquickcontrols2-gallery-pages-comboboxpage-qml.html
                      • qtquickcontrols2-gallery-pages-delegatepage-qml.html
                      • qtquickcontrols2-gallery-pages-dialpage-qml.html
                      • qtquickcontrols2-gallery-pages-drawerpage-qml.html
                      • qtquickcontrols2-gallery-pages-framepage-qml.html
                      • qtquickcontrols2-gallery-pages-groupboxpage-qml.html
                      • qtquickcontrols2-gallery-pages-menupage-qml.html
                      • qtquickcontrols2-gallery-pages-pageindicatorpage-qml.html
                      • qtquickcontrols2-gallery-pages-popuppage-qml.html
                      • qtquickcontrols2-gallery-pages-progressbarpage-qml.html
                      • qtquickcontrols2-gallery-pages-radiobuttonpage-qml.html
                      • qtquickcontrols2-gallery-pages-rangesliderpage-qml.html
                      • qtquickcontrols2-gallery-pages-scrollablepage-qml.html
                      • qtquickcontrols2-gallery-pages-scrollbarpage-qml.html
                      • qtquickcontrols2-gallery-pages-scrollindicatorpage-qml.html
                      • qtquickcontrols2-gallery-pages-sliderpage-qml.html
                      • qtquickcontrols2-gallery-pages-spinboxpage-qml.html
                      • qtquickcontrols2-gallery-pages-stackviewpage-qml.html
                      • qtquickcontrols2-gallery-pages-swipeviewpage-qml.html
                      • qtquickcontrols2-gallery-pages-switchpage-qml.html
                      • qtquickcontrols2-gallery-pages-tabbarpage-qml.html
                      • qtquickcontrols2-gallery-pages-textareapage-qml.html
                      • qtquickcontrols2-gallery-pages-textfieldpage-qml.html
                      • qtquickcontrols2-gallery-pages-tooltippage-qml.html
                      • qtquickcontrols2-gallery-pages-tumblerpage-qml.html
                      • qtquickcontrols2-gettingstarted.html
                      • qtquickcontrols2-guidelines.html
                      • qtquickcontrols2-highdpi.html
                      • qtquickcontrols2-index.html
                      • qtquickcontrols2-indicators.html
                      • qtquickcontrols2-input.html
                      • qtquickcontrols2-material.html
                      • qtquickcontrols2-menus.html
                      • qtquickcontrols2-module.html
                      • qtquickcontrols2-navigation.html
                      • qtquickcontrols2-popups.html
                      • qtquickcontrols2-styles.html
                      • qtquickcontrols2-universal.html
                      • qtquickcontrols2.index
                      • qtquickcontrols2.qhp
                      • qtquickcontrols2.qhp.sha1
                      • qtquickcontrols2.tags
                      • qtquicktemplates2-index.html
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtquickdialogs.qch
                    • qtquickdialogs
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • critical.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • information.png
                        • logo.png
                        • question.png
                        • replacefile.png
                        • systemdialogs-example.jpg
                        • warning.png
                      • qml-qtquick-dialogs-colordialog-members.html
                      • qml-qtquick-dialogs-colordialog.html
                      • qml-qtquick-dialogs-dialog-members.html
                      • qml-qtquick-dialogs-dialog.html
                      • qml-qtquick-dialogs-filedialog-members.html
                      • qml-qtquick-dialogs-filedialog.html
                      • qml-qtquick-dialogs-fontdialog-members.html
                      • qml-qtquick-dialogs-fontdialog.html
                      • qml-qtquick-dialogs-messagedialog-members.html
                      • qml-qtquick-dialogs-messagedialog.html
                      • qtquick-dialogs-qmlmodule.html
                      • qtquickdialog-examples.html
                      • qtquickdialogs-index.html
                      • qtquickdialogs-systemdialogs-colordialogs-qml.html
                      • qtquickdialogs-systemdialogs-customdialogs-qml.html
                      • qtquickdialogs-systemdialogs-example.html
                      • qtquickdialogs-systemdialogs-filedialogs-qml.html
                      • qtquickdialogs-systemdialogs-fontdialogs-qml.html
                      • qtquickdialogs-systemdialogs-main-cpp.html
                      • qtquickdialogs-systemdialogs-messagedialogs-qml.html
                      • qtquickdialogs-systemdialogs-systemdialogs-pro.html
                      • qtquickdialogs-systemdialogs-systemdialogs-qml.html
                      • qtquickdialogs-systemdialogs-systemdialogs-qrc.html
                      • qtquickdialogs.index
                      • qtquickdialogs.qhp
                      • qtquickdialogs.qhp.sha1
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtquickextras.qch
                    • qtquickextras
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • circulargauge.png
                        • delaybutton-activated.png
                        • delaybutton-progress.png
                        • delaybutton.png
                        • dial.png
                        • gauge.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • piemenu-boundingItem-example.png
                        • piemenu-boundingItem-null-example.png
                        • piemenu.png
                        • qtquickextras-example-dashboard.png
                        • qtquickextras-example-flat.png
                        • qtquickextras-example-gallery.png
                        • statusindicator-active.png
                        • statusindicator-green.png
                        • statusindicator-inactive.png
                        • togglebutton-checked.png
                        • togglebutton-unchecked.png
                        • tumbler.png
                        • used-in-examples
                          • dashboard
                            • images
                              • fuel-icon.png
                              • temperature-icon.png
                          • flat
                            • images
                              • piemenu-bw-normal.png
                              • piemenu-bw-pressed.png
                              • piemenu-image-bw.jpg
                              • piemenu-image-rgb.jpg
                              • piemenu-image-sepia.jpg
                              • piemenu-rgb-normal.png
                              • piemenu-rgb-pressed.png
                              • piemenu-sepia-normal.png
                              • piemenu-sepia-pressed.png
                          • gallery
                            • images
                              • background-light.png
                              • background.png
                              • center-light.png
                              • center.png
                              • icon-back.png
                              • icon-go.png
                              • icon-settings.png
                              • info.png
                              • needle-light.png
                              • needle.png
                              • qt-logo.png
                              • zoom_in.png
                              • zoom_out.png
                      • qml-qtquick-extras-circulargauge-members.html
                      • qml-qtquick-extras-circulargauge.html
                      • qml-qtquick-extras-delaybutton-members.html
                      • qml-qtquick-extras-delaybutton.html
                      • qml-qtquick-extras-dial-members.html
                      • qml-qtquick-extras-dial.html
                      • qml-qtquick-extras-gauge-members.html
                      • qml-qtquick-extras-gauge.html
                      • qml-qtquick-extras-picture-members.html
                      • qml-qtquick-extras-picture.html
                      • qml-qtquick-extras-piemenu-members.html
                      • qml-qtquick-extras-piemenu-obsolete.html
                      • qml-qtquick-extras-piemenu.html
                      • qml-qtquick-extras-statusindicator-members.html
                      • qml-qtquick-extras-statusindicator-obsolete.html
                      • qml-qtquick-extras-statusindicator.html
                      • qml-qtquick-extras-togglebutton-members.html
                      • qml-qtquick-extras-togglebutton.html
                      • qml-qtquick-extras-tumbler-members.html
                      • qml-qtquick-extras-tumbler.html
                      • qml-qtquick-extras-tumblercolumn-members.html
                      • qml-qtquick-extras-tumblercolumn.html
                      • qtquick-extras-qmlmodule.html
                      • qtquickextras-dashboard-dashboard-pro.html
                      • qtquickextras-dashboard-dashboard-qrc.html
                      • qtquickextras-dashboard-example.html
                      • qtquickextras-dashboard-main-cpp.html
                      • qtquickextras-dashboard-qml-dashboard-qml.html
                      • qtquickextras-dashboard-qml-dashboardgaugestyle-qml.html
                      • qtquickextras-dashboard-qml-icongaugestyle-qml.html
                      • qtquickextras-dashboard-qml-tachometerstyle-qml.html
                      • qtquickextras-dashboard-qml-turnindicator-qml.html
                      • qtquickextras-dashboard-qml-valuesource-qml.html
                      • qtquickextras-examples.html
                      • qtquickextras-flat-content-qml.html
                      • qtquickextras-flat-example.html
                      • qtquickextras-flat-flat-pro.html
                      • qtquickextras-flat-flat-qrc.html
                      • qtquickextras-flat-main-cpp.html
                      • qtquickextras-flat-main-qml.html
                      • qtquickextras-flat-settingsicon-qml.html
                      • qtquickextras-gallery-example.html
                      • qtquickextras-gallery-gallery-pro.html
                      • qtquickextras-gallery-gallery-qrc.html
                      • qtquickextras-gallery-main-cpp.html
                      • qtquickextras-gallery-qml-blackbuttonbackground-qml.html
                      • qtquickextras-gallery-qml-blackbuttonstyle-qml.html
                      • qtquickextras-gallery-qml-circulargaugedarkstyle-qml.html
                      • qtquickextras-gallery-qml-circulargaugedefaultstyle-qml.html
                      • qtquickextras-gallery-qml-circulargaugelightstyle-qml.html
                      • qtquickextras-gallery-qml-circulargaugeview-qml.html
                      • qtquickextras-gallery-qml-controllabel-qml.html
                      • qtquickextras-gallery-qml-controlview-qml.html
                      • qtquickextras-gallery-qml-controlviewtoolbar-qml.html
                      • qtquickextras-gallery-qml-customizerlabel-qml.html
                      • qtquickextras-gallery-qml-customizerslider-qml.html
                      • qtquickextras-gallery-qml-customizerswitch-qml.html
                      • qtquickextras-gallery-qml-flickablemoreindicator-qml.html
                      • qtquickextras-gallery-qml-gallery-qml.html
                      • qtquickextras-gallery-qml-piemenucontrolview-qml.html
                      • qtquickextras-gallery-qml-piemenudarkstyle-qml.html
                      • qtquickextras-gallery-qml-piemenudefaultstyle-qml.html
                      • qtquickextras-gallery-qml-stylepicker-qml.html
                      • qtquickextras-index.html
                      • qtquickextras-overview.html
                      • qtquickextras.index
                      • qtquickextras.qhp
                      • qtquickextras.qhp.sha1
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtscript.qch
                    • qtscript
                      • ecmascript.html
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • context2d-example-smileysmile.png
                        • context2d-example.png
                        • defaultprototypes-example.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • qtscript-debugger.png
                      • qscriptable-members.html
                      • qscriptable.html
                      • qscriptclass-members.html
                      • qscriptclass.html
                      • qscriptclasspropertyiterator-members.html
                      • qscriptclasspropertyiterator.html
                      • qscriptcontext-members.html
                      • qscriptcontext.html
                      • qscriptcontextinfo-members.html
                      • qscriptcontextinfo-obsolete.html
                      • qscriptcontextinfo.html
                      • qscriptengine-members.html
                      • qscriptengine-obsolete.html
                      • qscriptengine.html
                      • qscriptengineagent-members.html
                      • qscriptengineagent.html
                      • qscriptextensionplugin-members.html
                      • qscriptextensionplugin.html
                      • qscriptprogram-members.html
                      • qscriptprogram.html
                      • qscriptstring-members.html
                      • qscriptstring.html
                      • qscriptsyntaxcheckresult-members.html
                      • qscriptsyntaxcheckresult.html
                      • qscriptvalue-members.html
                      • qscriptvalue-obsolete.html
                      • qscriptvalue.html
                      • qscriptvalueiterator-members.html
                      • qscriptvalueiterator.html
                      • qtscript-index.html
                      • qtscript-module.html
                      • qtscript-script-context2d-context2d-cpp.html
                      • qtscript-script-context2d-context2d-h.html
                      • qtscript-script-context2d-context2d-pro.html
                      • qtscript-script-context2d-context2d-qrc.html
                      • qtscript-script-context2d-domimage-cpp.html
                      • qtscript-script-context2d-domimage-h.html
                      • qtscript-script-context2d-environment-cpp.html
                      • qtscript-script-context2d-environment-h.html
                      • qtscript-script-context2d-example.html
                      • qtscript-script-context2d-main-cpp.html
                      • qtscript-script-context2d-qcontext2dcanvas-cpp.html
                      • qtscript-script-context2d-qcontext2dcanvas-h.html
                      • qtscript-script-context2d-scripts-alpha-js.html
                      • qtscript-script-context2d-scripts-arc-js.html
                      • qtscript-script-context2d-scripts-bezier-js.html
                      • qtscript-script-context2d-scripts-clock-js.html
                      • qtscript-script-context2d-scripts-fill1-js.html
                      • qtscript-script-context2d-scripts-grad-js.html
                      • qtscript-script-context2d-scripts-linecap-js.html
                      • qtscript-script-context2d-scripts-linestye-js.html
                      • qtscript-script-context2d-scripts-moveto-js.html
                      • qtscript-script-context2d-scripts-moveto2-js.html
                      • qtscript-script-context2d-scripts-pacman-js.html
                      • qtscript-script-context2d-scripts-plasma-js.html
                      • qtscript-script-context2d-scripts-pong-js.html
                      • qtscript-script-context2d-scripts-quad-js.html
                      • qtscript-script-context2d-scripts-rgba-js.html
                      • qtscript-script-context2d-scripts-rotate-js.html
                      • qtscript-script-context2d-scripts-scale-js.html
                      • qtscript-script-context2d-scripts-stroke1-js.html
                      • qtscript-script-context2d-scripts-translate-js.html
                      • qtscript-script-context2d-window-cpp.html
                      • qtscript-script-context2d-window-h.html
                      • qtscript-script-defaultprototypes-code-js.html
                      • qtscript-script-defaultprototypes-defaultprototypes-pro.html
                      • qtscript-script-defaultprototypes-defaultprototypes-qrc.html
                      • qtscript-script-defaultprototypes-example.html
                      • qtscript-script-defaultprototypes-main-cpp.html
                      • qtscript-script-defaultprototypes-prototypes-cpp.html
                      • qtscript-script-defaultprototypes-prototypes-h.html
                      • qtscript-script-helloscript-example.html
                      • qtscript-script-helloscript-helloscript-js.html
                      • qtscript-script-helloscript-helloscript-pro.html
                      • qtscript-script-helloscript-helloscript-qrc.html
                      • qtscript-script-helloscript-main-cpp.html
                      • qtscript.index
                      • qtscript.qhp
                      • qtscript.qhp.sha1
                      • qtscriptdebugger-manual.html
                      • qtscriptextensions.html
                      • script.html
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtscripttools.qch
                    • qtscripttools
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                      • qscriptenginedebugger-members.html
                      • qscriptenginedebugger.html
                      • qtscripttools-index.html
                      • qtscripttools-module.html
                      • qtscripttools.index
                      • qtscripttools.qhp
                      • qtscripttools.qhp.sha1
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtscxml.qch
                    • qtscxml
                      • examples-manifest.xml
                      • examples-qtscxml.html
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • calculator-qml.png
                        • calculator.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • invoke-dynamic.png
                        • invoke-static.png
                        • logo.png
                        • mediaplayer.png
                        • pinball-statechart-global.png
                        • pinball-statechart-guicontrol.png
                        • pinball-statechart-internalstate.png
                        • pinball-statechart-logicalstate.png
                        • pinball-statechart-modestate.png
                        • pinball-statechart-onstate.png
                        • pinball-statechart-workflow.png
                        • pinball.png
                        • trafficlight.png
                      • qml-mediaplayer-qml-dynamic-members.html
                      • qml-mediaplayer-qml-dynamic.html
                      • qml-scxml-statemachineloader-members.html
                      • qml-scxml-statemachineloader.html
                      • qscxmlc.html
                      • qscxmlcppdatamodel-members.html
                      • qscxmlcppdatamodel.html
                      • qscxmldatamodel-members.html
                      • qscxmldatamodel.html
                      • qscxmlecmascriptdatamodel-members.html
                      • qscxmlecmascriptdatamodel.html
                      • qscxmlerror-members.html
                      • qscxmlerror.html
                      • qscxmlevent-members.html
                      • qscxmlevent.html
                      • qscxmleventfilter-members.html
                      • qscxmleventfilter.html
                      • qscxmlnulldatamodel-members.html
                      • qscxmlnulldatamodel.html
                      • qscxmlparser-loader-members.html
                      • qscxmlparser-loader.html
                      • qscxmlparser-members.html
                      • qscxmlparser.html
                      • qscxmlstatemachine-members.html
                      • qscxmlstatemachine.html
                      • qtscxml-calculator-qml-button-qml.html
                      • qtscxml-calculator-qml-calculator-qml-cpp.html
                      • qtscxml-calculator-qml-calculator-qml-pro.html
                      • qtscxml-calculator-qml-calculator-qml-qml.html
                      • qtscxml-calculator-qml-calculator-qml-qrc.html
                      • qtscxml-calculator-qml-example.html
                      • qtscxml-calculator-widgets-calculator-widgets-cpp.html
                      • qtscxml-calculator-widgets-calculator-widgets-pro.html
                      • qtscxml-calculator-widgets-example.html
                      • qtscxml-calculator-widgets-mainwindow-cpp.html
                      • qtscxml-calculator-widgets-mainwindow-h.html
                      • qtscxml-calculator-widgets-mainwindow-ui.html
                      • qtscxml-index.html
                      • qtscxml-instantiating-state-machines.html
                      • qtscxml-invoke-dynamic-example.html
                      • qtscxml-invoke-dynamic-invoke-dynamic-cpp.html
                      • qtscxml-invoke-dynamic-invoke-dynamic-pro.html
                      • qtscxml-invoke-dynamic-invoke-dynamic-qml.html
                      • qtscxml-invoke-dynamic-invoke-dynamic-qrc.html
                      • qtscxml-invoke-static-example.html
                      • qtscxml-invoke-static-invoke-static-cpp.html
                      • qtscxml-invoke-static-invoke-static-pro.html
                      • qtscxml-invoke-static-invoke-static-qml.html
                      • qtscxml-invoke-static-invoke-static-qrc.html
                      • qtscxml-mediaplayer-qml-cppdatamodel-example.html
                      • qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-cppdatamodel-scxml.html
                      • qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-qml-cppdatamodel-cpp.html
                      • qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-qml-cppdatamodel-pro.html
                      • qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-qml-cppdatamodel-qml.html
                      • qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-qml-cppdatamodel-qrc.html
                      • qtscxml-mediaplayer-qml-cppdatamodel-thedatamodel-cpp.html
                      • qtscxml-mediaplayer-qml-cppdatamodel-thedatamodel-h.html
                      • qtscxml-mediaplayer-qml-dynamic-example.html
                      • qtscxml-mediaplayer-qml-dynamic-mediaplayer-qml-dynamic-cpp.html
                      • qtscxml-mediaplayer-qml-dynamic-mediaplayer-qml-dynamic-pro.html
                      • qtscxml-mediaplayer-qml-dynamic-mediaplayer-qml-dynamic-qml.html
                      • qtscxml-mediaplayer-qml-dynamic-mediaplayer-qml-dynamic-qrc.html
                      • qtscxml-mediaplayer-qml-static-example.html
                      • qtscxml-mediaplayer-qml-static-mediaplayer-qml-static-cpp.html
                      • qtscxml-mediaplayer-qml-static-mediaplayer-qml-static-pro.html
                      • qtscxml-mediaplayer-qml-static-mediaplayer-qml-static-qml.html
                      • qtscxml-mediaplayer-qml-static-mediaplayer-qml-static-qrc.html
                      • qtscxml-mediaplayer-widgets-dynamic-example.html
                      • qtscxml-mediaplayer-widgets-dynamic-mediaplayer-qrc.html
                      • qtscxml-mediaplayer-widgets-dynamic-mediaplayer-widgets-dynamic-cpp.html
                      • qtscxml-mediaplayer-widgets-dynamic-mediaplayer-widgets-dynamic-pro.html
                      • qtscxml-mediaplayer-widgets-static-example.html
                      • qtscxml-mediaplayer-widgets-static-mediaplayer-widgets-static-cpp.html
                      • qtscxml-mediaplayer-widgets-static-mediaplayer-widgets-static-pro.html
                      • qtscxml-module.html
                      • qtscxml-overview.html
                      • qtscxml-pinball-example.html
                      • qtscxml-pinball-main-cpp.html
                      • qtscxml-pinball-mainwindow-cpp.html
                      • qtscxml-pinball-mainwindow-h.html
                      • qtscxml-pinball-mainwindow-ui.html
                      • qtscxml-pinball-pinball-pro.html
                      • qtscxml-pinball-pinball-scxml.html
                      • qtscxml-scxml-compliance.html
                      • qtscxml-trafficlight-qml-dynamic-example.html
                      • qtscxml-trafficlight-qml-dynamic-trafficlight-qml-dynamic-cpp.html
                      • qtscxml-trafficlight-qml-dynamic-trafficlight-qml-dynamic-pro.html
                      • qtscxml-trafficlight-qml-dynamic-trafficlight-qml-dynamic-qml.html
                      • qtscxml-trafficlight-qml-dynamic-trafficlight-qml-dynamic-qrc.html
                      • qtscxml-trafficlight-qml-static-example.html
                      • qtscxml-trafficlight-qml-static-trafficlight-qml-static-cpp.html
                      • qtscxml-trafficlight-qml-static-trafficlight-qml-static-pro.html
                      • qtscxml-trafficlight-qml-static-trafficlight-qml-static-qml.html
                      • qtscxml-trafficlight-qml-static-trafficlight-qml-static-qrc.html
                      • qtscxml-trafficlight-widgets-dynamic-example.html
                      • qtscxml-trafficlight-widgets-dynamic-trafficlight-widgets-dynamic-cpp.html
                      • qtscxml-trafficlight-widgets-dynamic-trafficlight-widgets-dynamic-pro.html
                      • qtscxml-trafficlight-widgets-dynamic-trafficlight-widgets-dynamic-qrc.html
                      • qtscxml-trafficlight-widgets-static-example.html
                      • qtscxml-trafficlight-widgets-static-trafficlight-widgets-static-cpp.html
                      • qtscxml-trafficlight-widgets-static-trafficlight-widgets-static-pro.html
                      • qtscxml-trafficlight-widgets-static-trafficlight-widgets-static-qrc.html
                      • qtscxml.index
                      • qtscxml.qhp
                      • qtscxml.qhp.sha1
                      • qtscxml.tags
                      • scxml-qmlmodule.html
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtsensors.qch
                    • qtsensors
                      • compatmap.html
                      • creating-a-sensor-plugin.html
                      • determining-the-default-sensor-for-a-type.html
                      • dynamic-sensor-backend-registration.html
                      • examples-manifest.xml
                      • genericbackend.html
                      • images
                        • accelbubble.png
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • maze.png
                        • qmlqtsensors.png
                        • qtsensors-examples-explorer.png
                        • qtsensors-examples-grue.png
                        • sensorgesture-cover.png
                        • sensorgesture-doubletap.png
                        • sensorgesture-facedown.png
                        • sensorgesture-faceup.png
                        • sensorgesture-hover.png
                        • sensorgesture-shake.png
                        • sensorgesture-slam_1.png
                        • sensorgesture-slam_2.png
                        • sensorgesture-twist.png
                        • sensorgesture-whip.png
                        • sensorgesturecpp.png
                        • sensors-coordinates.jpg
                        • sensors-coordinates2.jpg
                        • sensors-coordinates3.jpg
                        • sensors-dynamic.png
                        • sensors-geo-vs-raw-magnetism.jpg
                        • sensors-orientation.jpg
                        • sensors-overview.png
                        • sensors-rotation-anim.gif
                        • sensors-rotation.jpg
                        • sensors-rotation2.jpg
                        • sensors-rotation3.jpg
                        • sensors-sides.jpg
                        • sensors-sides2.jpg
                        • sensors-static.png
                        • shakeit.png
                      • qaccelerometer-members.html
                      • qaccelerometer.html
                      • qaccelerometerfilter-members.html
                      • qaccelerometerfilter.html
                      • qaccelerometerreading-members.html
                      • qaccelerometerreading.html
                      • qaltimeter-members.html
                      • qaltimeter.html
                      • qaltimeterfilter-members.html
                      • qaltimeterfilter.html
                      • qaltimeterreading-members.html
                      • qaltimeterreading.html
                      • qambientlightfilter-members.html
                      • qambientlightfilter.html
                      • qambientlightreading-members.html
                      • qambientlightreading.html
                      • qambientlightsensor-members.html
                      • qambientlightsensor.html
                      • qambienttemperaturefilter-members.html
                      • qambienttemperaturefilter.html
                      • qambienttemperaturereading-members.html
                      • qambienttemperaturereading.html
                      • qambienttemperaturesensor-members.html
                      • qambienttemperaturesensor.html
                      • qcompass-members.html
                      • qcompass.html
                      • qcompassfilter-members.html
                      • qcompassfilter.html
                      • qcompassreading-members.html
                      • qcompassreading.html
                      • qdistancefilter-members.html
                      • qdistancefilter.html
                      • qdistancereading-members.html
                      • qdistancereading.html
                      • qdistancesensor-members.html
                      • qdistancesensor.html
                      • qgyroscope-members.html
                      • qgyroscope.html
                      • qgyroscopefilter-members.html
                      • qgyroscopefilter.html
                      • qgyroscopereading-members.html
                      • qgyroscopereading.html
                      • qholsterfilter-members.html
                      • qholsterfilter.html
                      • qholsterreading-members.html
                      • qholsterreading.html
                      • qholstersensor-members.html
                      • qholstersensor.html
                      • qirproximityfilter-members.html
                      • qirproximityfilter.html
                      • qirproximityreading-members.html
                      • qirproximityreading.html
                      • qirproximitysensor-members.html
                      • qirproximitysensor.html
                      • qlightfilter-members.html
                      • qlightfilter.html
                      • qlightreading-members.html
                      • qlightreading.html
                      • qlightsensor-members.html
                      • qlightsensor.html
                      • qmagnetometer-members.html
                      • qmagnetometer.html
                      • qmagnetometerfilter-members.html
                      • qmagnetometerfilter.html
                      • qmagnetometerreading-members.html
                      • qmagnetometerreading.html
                      • qml-qtsensors-accelerometer-members.html
                      • qml-qtsensors-accelerometer.html
                      • qml-qtsensors-accelerometerreading-members.html
                      • qml-qtsensors-accelerometerreading.html
                      • qml-qtsensors-altimeter-members.html
                      • qml-qtsensors-altimeter.html
                      • qml-qtsensors-altimeterreading-members.html
                      • qml-qtsensors-altimeterreading.html
                      • qml-qtsensors-ambientlightreading-members.html
                      • qml-qtsensors-ambientlightreading.html
                      • qml-qtsensors-ambientlightsensor-members.html
                      • qml-qtsensors-ambientlightsensor.html
                      • qml-qtsensors-ambienttemperaturereading-members.html
                      • qml-qtsensors-ambienttemperaturereading.html
                      • qml-qtsensors-ambienttemperaturesensor-members.html
                      • qml-qtsensors-ambienttemperaturesensor.html
                      • qml-qtsensors-compass-members.html
                      • qml-qtsensors-compass.html
                      • qml-qtsensors-compassreading-members.html
                      • qml-qtsensors-compassreading.html
                      • qml-qtsensors-distancereading-members.html
                      • qml-qtsensors-distancereading.html
                      • qml-qtsensors-distancesensor-members.html
                      • qml-qtsensors-distancesensor.html
                      • qml-qtsensors-gyroscope-members.html
                      • qml-qtsensors-gyroscope.html
                      • qml-qtsensors-gyroscopereading-members.html
                      • qml-qtsensors-gyroscopereading.html
                      • qml-qtsensors-holsterreading-members.html
                      • qml-qtsensors-holsterreading.html
                      • qml-qtsensors-holstersensor-members.html
                      • qml-qtsensors-holstersensor.html
                      • qml-qtsensors-irproximityreading-members.html
                      • qml-qtsensors-irproximityreading.html
                      • qml-qtsensors-irproximitysensor-members.html
                      • qml-qtsensors-irproximitysensor.html
                      • qml-qtsensors-lightreading-members.html
                      • qml-qtsensors-lightreading.html
                      • qml-qtsensors-lightsensor-members.html
                      • qml-qtsensors-lightsensor.html
                      • qml-qtsensors-magnetometer-members.html
                      • qml-qtsensors-magnetometer.html
                      • qml-qtsensors-magnetometerreading-members.html
                      • qml-qtsensors-magnetometerreading.html
                      • qml-qtsensors-orientationreading-members.html
                      • qml-qtsensors-orientationreading.html
                      • qml-qtsensors-orientationsensor-members.html
                      • qml-qtsensors-orientationsensor.html
                      • qml-qtsensors-pressurereading-members.html
                      • qml-qtsensors-pressurereading.html
                      • qml-qtsensors-pressuresensor-members.html
                      • qml-qtsensors-pressuresensor.html
                      • qml-qtsensors-proximityreading-members.html
                      • qml-qtsensors-proximityreading.html
                      • qml-qtsensors-proximitysensor-members.html
                      • qml-qtsensors-proximitysensor.html
                      • qml-qtsensors-rotationreading-members.html
                      • qml-qtsensors-rotationreading.html
                      • qml-qtsensors-rotationsensor-members.html
                      • qml-qtsensors-rotationsensor.html
                      • qml-qtsensors-sensor-members.html
                      • qml-qtsensors-sensor.html
                      • qml-qtsensors-sensorgesture-members.html
                      • qml-qtsensors-sensorgesture.html
                      • qml-qtsensors-sensorglobal-members.html
                      • qml-qtsensors-sensorglobal.html
                      • qml-qtsensors-sensorreading-members.html
                      • qml-qtsensors-sensorreading.html
                      • qml-qtsensors-tapreading-members.html
                      • qml-qtsensors-tapreading.html
                      • qml-qtsensors-tapsensor-members.html
                      • qml-qtsensors-tapsensor.html
                      • qml-qtsensors-tiltreading-members.html
                      • qml-qtsensors-tiltreading.html
                      • qml-qtsensors-tiltsensor-members.html
                      • qml-qtsensors-tiltsensor.html
                      • qorientationfilter-members.html
                      • qorientationfilter.html
                      • qorientationreading-members.html
                      • qorientationreading.html
                      • qorientationsensor-members.html
                      • qorientationsensor.html
                      • qpressurefilter-members.html
                      • qpressurefilter.html
                      • qpressurereading-members.html
                      • qpressurereading.html
                      • qpressuresensor-members.html
                      • qpressuresensor.html
                      • qproximityfilter-members.html
                      • qproximityfilter.html
                      • qproximityreading-members.html
                      • qproximityreading.html
                      • qproximitysensor-members.html
                      • qproximitysensor.html
                      • qrotationfilter-members.html
                      • qrotationfilter.html
                      • qrotationreading-members.html
                      • qrotationreading.html
                      • qrotationsensor-members.html
                      • qrotationsensor.html
                      • qsensor-members.html
                      • qsensor.html
                      • qsensorbackend-members.html
                      • qsensorbackend.html
                      • qsensorbackendfactory-members.html
                      • qsensorbackendfactory.html
                      • qsensorchangesinterface-members.html
                      • qsensorchangesinterface.html
                      • qsensorfilter-members.html
                      • qsensorfilter.html
                      • qsensorgesture-members.html
                      • qsensorgesture.html
                      • qsensorgesturemanager-members.html
                      • qsensorgesturemanager.html
                      • qsensorgestureplugininterface-members.html
                      • qsensorgestureplugininterface.html
                      • qsensorgesturerecognizer-members.html
                      • qsensorgesturerecognizer.html
                      • qsensormanager-members.html
                      • qsensormanager.html
                      • qsensorplugininterface-members.html
                      • qsensorplugininterface.html
                      • qsensorreading-members.html
                      • qsensorreading.html
                      • qtapfilter-members.html
                      • qtapfilter.html
                      • qtapreading-members.html
                      • qtapreading.html
                      • qtapsensor-members.html
                      • qtapsensor.html
                      • qtiltfilter-members.html
                      • qtiltfilter.html
                      • qtiltreading-members.html
                      • qtiltreading.html
                      • qtiltsensor-members.html
                      • qtiltsensor.html
                      • qtsensorgestures-cpp.html
                      • qtsensors-accelbubble-accelbubble-pro.html
                      • qtsensors-accelbubble-accelbubble-qml.html
                      • qtsensors-accelbubble-accelbubble-qrc.html
                      • qtsensors-accelbubble-android-androidmanifest-xml.html
                      • qtsensors-accelbubble-content-bluebubble-svg.html
                      • qtsensors-accelbubble-example.html
                      • qtsensors-accelbubble-main-cpp.html
                      • qtsensors-cpp.html
                      • qtsensors-examples.html
                      • qtsensors-grue-console-app-console-app-pro.html
                      • qtsensors-grue-example.html
                      • qtsensors-grue-grue-pro.html
                      • qtsensors-grue-grue-qml.html
                      • qtsensors-grue-import-import-pro.html
                      • qtsensors-grue-import-qmldir.html
                      • qtsensors-grue-lib-gruesensor-cpp.html
                      • qtsensors-grue-lib-gruesensor-h.html
                      • qtsensors-grue-lib-gruesensor-p-h.html
                      • qtsensors-grue-lib-lib-pro.html
                      • qtsensors-grue-main-cpp.html
                      • qtsensors-grue-makefile-qml.html
                      • qtsensors-grue-plugin-gruesensorimpl-cpp.html
                      • qtsensors-grue-plugin-gruesensorimpl-h.html
                      • qtsensors-grue-plugin-plugin-pro.html
                      • qtsensors-grue-qml-pro.html
                      • qtsensors-grue-qml-qrc.html
                      • qtsensors-index.html
                      • qtsensors-maze-android-androidmanifest-xml.html
                      • qtsensors-maze-components-applicationwindow-qml.html
                      • qtsensors-maze-components-button-qml.html
                      • qtsensors-maze-congratulation-qml.html
                      • qtsensors-maze-example.html
                      • qtsensors-maze-labyrinthsquare-qml.html
                      • qtsensors-maze-lib-js.html
                      • qtsensors-maze-main-cpp.html
                      • qtsensors-maze-maze-pro.html
                      • qtsensors-maze-maze-qml.html
                      • qtsensors-maze-maze-qrc.html
                      • qtsensors-maze-mouse-qml.html
                      • qtsensors-module.html
                      • qtsensors-porting.html
                      • qtsensors-qmlmodule.html
                      • qtsensors-qmlqtsensors-components-applicationwindow-qml.html
                      • qtsensors-qmlqtsensors-components-button-qml.html
                      • qtsensors-qmlqtsensors-components-divider-qml.html
                      • qtsensors-qmlqtsensors-example.html
                      • qtsensors-qmlqtsensors-main-cpp.html
                      • qtsensors-qmlqtsensors-qmlqtsensors-pro.html
                      • qtsensors-qmlqtsensors-qmlqtsensors-qml.html
                      • qtsensors-qmlqtsensors-qmlqtsensors-qrc.html
                      • qtsensors-qmlsensorgestures-button-qml.html
                      • qtsensors-qmlsensorgestures-example.html
                      • qtsensors-qmlsensorgestures-gesturelist-qml.html
                      • qtsensors-qmlsensorgestures-gesturesview-qml.html
                      • qtsensors-qmlsensorgestures-gestureview-qml.html
                      • qtsensors-qmlsensorgestures-main-cpp.html
                      • qtsensors-qmlsensorgestures-makefile-qml.html
                      • qtsensors-qmlsensorgestures-plugin-plugin-pro.html
                      • qtsensors-qmlsensorgestures-plugin-qcountergestureplugin-cpp.html
                      • qtsensors-qmlsensorgestures-plugin-qcountergestureplugin-h.html
                      • qtsensors-qmlsensorgestures-plugin-qcounterrecognizer-cpp.html
                      • qtsensors-qmlsensorgestures-plugin-qcounterrecognizer-h.html
                      • qtsensors-qmlsensorgestures-qml-pro.html
                      • qtsensors-qmlsensorgestures-qml-qrc.html
                      • qtsensors-qmlsensorgestures-qmlsensorgestures-pro.html
                      • qtsensors-qmlsensorgestures-qmlsensorgestures-qml.html
                      • qtsensors-sensor-explorer-example.html
                      • qtsensors-sensor-explorer-import-explorer-cpp.html
                      • qtsensors-sensor-explorer-import-explorer-h.html
                      • qtsensors-sensor-explorer-import-import-pro.html
                      • qtsensors-sensor-explorer-import-propertyinfo-cpp.html
                      • qtsensors-sensor-explorer-import-propertyinfo-h.html
                      • qtsensors-sensor-explorer-import-qmldir.html
                      • qtsensors-sensor-explorer-import-sensoritem-cpp.html
                      • qtsensors-sensor-explorer-import-sensoritem-h.html
                      • qtsensors-sensor-explorer-main-cpp.html
                      • qtsensors-sensor-explorer-makefile-qml.html
                      • qtsensors-sensor-explorer-qml-pro.html
                      • qtsensors-sensor-explorer-qml-qrc.html
                      • qtsensors-sensor-explorer-sensor-explorer-pro.html
                      • qtsensors-sensor-explorer-sensor-explorer-qml.html
                      • qtsensors-sensorgestures-example.html
                      • qtsensors-sensorgestures-main-cpp.html
                      • qtsensors-sensorgestures-mainwindow-cpp.html
                      • qtsensors-sensorgestures-mainwindow-h.html
                      • qtsensors-sensorgestures-mainwindow-ui.html
                      • qtsensors-sensorgestures-sensorgestures-pro.html
                      • qtsensors-shakeit-example.html
                      • qtsensors-shakeit-main-cpp.html
                      • qtsensors-shakeit-shakeit-pro.html
                      • qtsensors-shakeit-shakeit-qml.html
                      • qtsensors-shakeit-shakeit-qrc.html
                      • qtsensors.index
                      • qtsensors.qhp
                      • qtsensors.qhp.sha1
                      • qtsensors.tags
                      • senorfwbackend.html
                      • sensorgesture-emulator-topics.html
                      • sensorgesture-plugins-topics.html
                      • sensors-backend-topics.html
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtserialbus.qch
                    • qtserialbus
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • can-example.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • modbusmaster.png
                        • modbusserver.png
                        • used-in-examples
                          • can
                            • images
                              • application-exit.png
                              • clear.png
                              • connect.png
                              • disconnect.png
                          • modbus
                            • master
                              • images
                                • application-exit.png
                                • connect.png
                                • disconnect.png
                                • settings.png
                            • slave
                              • images
                                • application-exit.png
                                • connect.png
                                • disconnect.png
                                • settings.png
                      • qcanbus-members.html
                      • qcanbus.html
                      • qcanbusdevice-filter-members.html
                      • qcanbusdevice-filter.html
                      • qcanbusdevice-members.html
                      • qcanbusdevice.html
                      • qcanbusfactory-members.html
                      • qcanbusfactory.html
                      • qcanbusframe-members.html
                      • qcanbusframe-timestamp-members.html
                      • qcanbusframe-timestamp.html
                      • qcanbusframe.html
                      • qmodbusclient-members.html
                      • qmodbusclient.html
                      • qmodbusdataunit-members.html
                      • qmodbusdataunit.html
                      • qmodbusdevice-members.html
                      • qmodbusdevice.html
                      • qmodbusdeviceidentification-members.html
                      • qmodbusdeviceidentification.html
                      • qmodbusexceptionresponse-members.html
                      • qmodbusexceptionresponse.html
                      • qmodbuspdu-members.html
                      • qmodbuspdu.html
                      • qmodbusreply-members.html
                      • qmodbusreply.html
                      • qmodbusrequest-members.html
                      • qmodbusrequest.html
                      • qmodbusresponse-members.html
                      • qmodbusresponse.html
                      • qmodbusrtuserialmaster-members.html
                      • qmodbusrtuserialmaster.html
                      • qmodbusrtuserialslave-members.html
                      • qmodbusrtuserialslave.html
                      • qmodbusserver-members.html
                      • qmodbusserver.html
                      • qmodbustcpclient-members.html
                      • qmodbustcpclient.html
                      • qmodbustcpserver-members.html
                      • qmodbustcpserver.html
                      • qtcanbus-backends.html
                      • qtmodbus-backends.html
                      • qtserialbus-can-can-pro.html
                      • qtserialbus-can-can-qrc.html
                      • qtserialbus-can-connectdialog-cpp.html
                      • qtserialbus-can-connectdialog-h.html
                      • qtserialbus-can-connectdialog-ui.html
                      • qtserialbus-can-example.html
                      • qtserialbus-can-main-cpp.html
                      • qtserialbus-can-mainwindow-cpp.html
                      • qtserialbus-can-mainwindow-h.html
                      • qtserialbus-can-mainwindow-ui.html
                      • qtserialbus-examples.html
                      • qtserialbus-index.html
                      • qtserialbus-modbus-master-example.html
                      • qtserialbus-modbus-master-main-cpp.html
                      • qtserialbus-modbus-master-mainwindow-cpp.html
                      • qtserialbus-modbus-master-mainwindow-h.html
                      • qtserialbus-modbus-master-mainwindow-ui.html
                      • qtserialbus-modbus-master-master-pro.html
                      • qtserialbus-modbus-master-master-qrc.html
                      • qtserialbus-modbus-master-settingsdialog-cpp.html
                      • qtserialbus-modbus-master-settingsdialog-h.html
                      • qtserialbus-modbus-master-settingsdialog-ui.html
                      • qtserialbus-modbus-master-writeregistermodel-cpp.html
                      • qtserialbus-modbus-master-writeregistermodel-h.html
                      • qtserialbus-modbus-slave-example.html
                      • qtserialbus-modbus-slave-main-cpp.html
                      • qtserialbus-modbus-slave-mainwindow-cpp.html
                      • qtserialbus-modbus-slave-mainwindow-h.html
                      • qtserialbus-modbus-slave-mainwindow-ui.html
                      • qtserialbus-modbus-slave-settingsdialog-cpp.html
                      • qtserialbus-modbus-slave-settingsdialog-h.html
                      • qtserialbus-modbus-slave-settingsdialog-ui.html
                      • qtserialbus-modbus-slave-slave-pro.html
                      • qtserialbus-modbus-slave-slave-qrc.html
                      • qtserialbus-module.html
                      • qtserialbus-peakcan-overview.html
                      • qtserialbus-socketcan-overview.html
                      • qtserialbus-tinycan-overview.html
                      • qtserialbus.index
                      • qtserialbus.qhp
                      • qtserialbus.qhp.sha1
                      • qtserialbus.tags
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtserialport.qch
                    • qtserialport
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • blockingmaster-example.png
                        • blockingslave-example.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • cenumerator-example.png
                        • creaderasync-example.png
                        • creadersync-example.png
                        • cwriterasync-example.png
                        • cwritersync-example.png
                        • enumerator-example.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • terminal-example.png
                        • used-in-examples
                          • terminal
                            • images
                              • application-exit.png
                              • clear.png
                              • connect.png
                              • disconnect.png
                              • settings.png
                      • qserialport-members.html
                      • qserialport-obsolete.html
                      • qserialport.html
                      • qserialportinfo-members.html
                      • qserialportinfo-obsolete.html
                      • qserialportinfo.html
                      • qtserialport-blockingmaster-blockingmaster-pro.html
                      • qtserialport-blockingmaster-dialog-cpp.html
                      • qtserialport-blockingmaster-dialog-h.html
                      • qtserialport-blockingmaster-example.html
                      • qtserialport-blockingmaster-main-cpp.html
                      • qtserialport-blockingmaster-masterthread-cpp.html
                      • qtserialport-blockingmaster-masterthread-h.html
                      • qtserialport-blockingslave-blockingslave-pro.html
                      • qtserialport-blockingslave-dialog-cpp.html
                      • qtserialport-blockingslave-dialog-h.html
                      • qtserialport-blockingslave-example.html
                      • qtserialport-blockingslave-main-cpp.html
                      • qtserialport-blockingslave-slavethread-cpp.html
                      • qtserialport-blockingslave-slavethread-h.html
                      • qtserialport-cenumerator-cenumerator-pro.html
                      • qtserialport-cenumerator-example.html
                      • qtserialport-cenumerator-main-cpp.html
                      • qtserialport-creaderasync-creaderasync-pro.html
                      • qtserialport-creaderasync-example.html
                      • qtserialport-creaderasync-main-cpp.html
                      • qtserialport-creaderasync-serialportreader-cpp.html
                      • qtserialport-creaderasync-serialportreader-h.html
                      • qtserialport-creadersync-creadersync-pro.html
                      • qtserialport-creadersync-example.html
                      • qtserialport-creadersync-main-cpp.html
                      • qtserialport-cwriterasync-cwriterasync-pro.html
                      • qtserialport-cwriterasync-example.html
                      • qtserialport-cwriterasync-main-cpp.html
                      • qtserialport-cwriterasync-serialportwriter-cpp.html
                      • qtserialport-cwriterasync-serialportwriter-h.html
                      • qtserialport-cwritersync-cwritersync-pro.html
                      • qtserialport-cwritersync-example.html
                      • qtserialport-cwritersync-main-cpp.html
                      • qtserialport-enumerator-enumerator-pro.html
                      • qtserialport-enumerator-example.html
                      • qtserialport-enumerator-main-cpp.html
                      • qtserialport-examples.html
                      • qtserialport-index.html
                      • qtserialport-module.html
                      • qtserialport-terminal-console-cpp.html
                      • qtserialport-terminal-console-h.html
                      • qtserialport-terminal-example.html
                      • qtserialport-terminal-main-cpp.html
                      • qtserialport-terminal-mainwindow-cpp.html
                      • qtserialport-terminal-mainwindow-h.html
                      • qtserialport-terminal-mainwindow-ui.html
                      • qtserialport-terminal-settingsdialog-cpp.html
                      • qtserialport-terminal-settingsdialog-h.html
                      • qtserialport-terminal-settingsdialog-ui.html
                      • qtserialport-terminal-terminal-pro.html
                      • qtserialport-terminal-terminal-qrc.html
                      • qtserialport.index
                      • qtserialport.qhp
                      • qtserialport.qhp.sha1
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtsql.qch
                    • qtsql
                      • database.html
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • books-demo.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • cachedtable-example.png
                        • drilldown-example.png
                        • foreignkeys.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • insertrowinmodelview.png
                        • logo.png
                        • masterdetail-example.png
                        • noforeignkeys.png
                        • qdatawidgetmapper-simple.png
                        • querymodel-example.png
                        • relationaltable.png
                        • relationaltablemodel-example.png
                        • sql-widget-mapper.png
                        • sqlbrowser-demo.png
                        • tablemodel-example.png
                        • used-in-examples
                          • books
                            • images
                              • star.png
                          • drilldown
                            • images
                              • qt-creator.png
                              • qt-logo.png
                              • qt-project.png
                              • qt-quick.png
                          • masterdetail
                            • images
                              • icon.png
                              • image.png
                        • widgetmapper-sql-mapping-table.png
                        • widgetmapper-sql-mapping.png
                      • qsql.html
                      • qsqldatabase-members.html
                      • qsqldatabase.html
                      • qsqldriver-members.html
                      • qsqldriver.html
                      • qsqldrivercreator-members.html
                      • qsqldrivercreator.html
                      • qsqldrivercreatorbase-members.html
                      • qsqldrivercreatorbase.html
                      • qsqldriverplugin-members.html
                      • qsqldriverplugin.html
                      • qsqlerror-members.html
                      • qsqlerror-obsolete.html
                      • qsqlerror.html
                      • qsqlfield-members.html
                      • qsqlfield.html
                      • qsqlindex-members.html
                      • qsqlindex.html
                      • qsqlquery-members.html
                      • qsqlquery.html
                      • qsqlquerymodel-members.html
                      • qsqlquerymodel.html
                      • qsqlrecord-members.html
                      • qsqlrecord.html
                      • qsqlrelation-members.html
                      • qsqlrelation.html
                      • qsqlrelationaldelegate-members.html
                      • qsqlrelationaldelegate.html
                      • qsqlrelationaltablemodel-members.html
                      • qsqlrelationaltablemodel.html
                      • qsqlresult-members.html
                      • qsqlresult.html
                      • qsqltablemodel-members.html
                      • qsqltablemodel.html
                      • qtsql-books-bookdelegate-cpp.html
                      • qtsql-books-bookdelegate-h.html
                      • qtsql-books-books-pro.html
                      • qtsql-books-books-qrc.html
                      • qtsql-books-bookwindow-cpp.html
                      • qtsql-books-bookwindow-h.html
                      • qtsql-books-bookwindow-ui.html
                      • qtsql-books-example.html
                      • qtsql-books-initdb-h.html
                      • qtsql-books-main-cpp.html
                      • qtsql-cachedtable-cachedtable-pro.html
                      • qtsql-cachedtable-example.html
                      • qtsql-cachedtable-main-cpp.html
                      • qtsql-cachedtable-tableeditor-cpp.html
                      • qtsql-cachedtable-tableeditor-h.html
                      • qtsql-drilldown-drilldown-pro.html
                      • qtsql-drilldown-drilldown-qrc.html
                      • qtsql-drilldown-example.html
                      • qtsql-drilldown-imageitem-cpp.html
                      • qtsql-drilldown-imageitem-h.html
                      • qtsql-drilldown-informationwindow-cpp.html
                      • qtsql-drilldown-informationwindow-h.html
                      • qtsql-drilldown-main-cpp.html
                      • qtsql-drilldown-view-cpp.html
                      • qtsql-drilldown-view-h.html
                      • qtsql-index.html
                      • qtsql-masterdetail-albumdetails-xml.html
                      • qtsql-masterdetail-database-h.html
                      • qtsql-masterdetail-dialog-cpp.html
                      • qtsql-masterdetail-dialog-h.html
                      • qtsql-masterdetail-example.html
                      • qtsql-masterdetail-main-cpp.html
                      • qtsql-masterdetail-mainwindow-cpp.html
                      • qtsql-masterdetail-mainwindow-h.html
                      • qtsql-masterdetail-masterdetail-pro.html
                      • qtsql-masterdetail-masterdetail-qrc.html
                      • qtsql-module.html
                      • qtsql-querymodel-customsqlmodel-cpp.html
                      • qtsql-querymodel-customsqlmodel-h.html
                      • qtsql-querymodel-editablesqlmodel-cpp.html
                      • qtsql-querymodel-editablesqlmodel-h.html
                      • qtsql-querymodel-example.html
                      • qtsql-querymodel-main-cpp.html
                      • qtsql-querymodel-querymodel-pro.html
                      • qtsql-relationaltablemodel-example.html
                      • qtsql-relationaltablemodel-relationaltablemodel-cpp.html
                      • qtsql-relationaltablemodel-relationaltablemodel-pro.html
                      • qtsql-sqlbrowser-browser-cpp.html
                      • qtsql-sqlbrowser-browser-h.html
                      • qtsql-sqlbrowser-browserwidget-ui.html
                      • qtsql-sqlbrowser-connectionwidget-cpp.html
                      • qtsql-sqlbrowser-connectionwidget-h.html
                      • qtsql-sqlbrowser-example.html
                      • qtsql-sqlbrowser-main-cpp.html
                      • qtsql-sqlbrowser-qsqlconnectiondialog-cpp.html
                      • qtsql-sqlbrowser-qsqlconnectiondialog-h.html
                      • qtsql-sqlbrowser-qsqlconnectiondialog-ui.html
                      • qtsql-sqlbrowser-sqlbrowser-pro.html
                      • qtsql-sqlwidgetmapper-example.html
                      • qtsql-sqlwidgetmapper-main-cpp.html
                      • qtsql-sqlwidgetmapper-sqlwidgetmapper-pro.html
                      • qtsql-sqlwidgetmapper-window-cpp.html
                      • qtsql-sqlwidgetmapper-window-h.html
                      • qtsql-tablemodel-example.html
                      • qtsql-tablemodel-tablemodel-cpp.html
                      • qtsql-tablemodel-tablemodel-pro.html
                      • qtsql.index
                      • qtsql.qhp
                      • qtsql.qhp.sha1
                      • qtsql.tags
                      • sql-connecting.html
                      • sql-driver.html
                      • sql-forms.html
                      • sql-model.html
                      • sql-presenting.html
                      • sql-programming.html
                      • sql-sqlstatements.html
                      • sql-types.html
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtsvg.qch
                    • qtsvg
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • svggenerator-example.png
                        • svgviewer-example.png
                        • textobject-example.png
                      • qgraphicssvgitem-members.html
                      • qgraphicssvgitem-obsolete.html
                      • qgraphicssvgitem.html
                      • qsvggenerator-members.html
                      • qsvggenerator.html
                      • qsvgrenderer-members.html
                      • qsvgrenderer.html
                      • qsvgwidget-members.html
                      • qsvgwidget.html
                      • qtsvg-index.html
                      • qtsvg-module.html
                      • qtsvg-richtext-textobject-example.html
                      • qtsvg-richtext-textobject-files-heart-svg.html
                      • qtsvg-richtext-textobject-main-cpp.html
                      • qtsvg-richtext-textobject-resources-qrc.html
                      • qtsvg-richtext-textobject-svgtextobject-cpp.html
                      • qtsvg-richtext-textobject-svgtextobject-h.html
                      • qtsvg-richtext-textobject-textobject-pro.html
                      • qtsvg-richtext-textobject-window-cpp.html
                      • qtsvg-richtext-textobject-window-h.html
                      • qtsvg-svggenerator-displaywidget-cpp.html
                      • qtsvg-svggenerator-displaywidget-h.html
                      • qtsvg-svggenerator-example.html
                      • qtsvg-svggenerator-forms-window-ui.html
                      • qtsvg-svggenerator-main-cpp.html
                      • qtsvg-svggenerator-svggenerator-pro.html
                      • qtsvg-svggenerator-svggenerator-qrc.html
                      • qtsvg-svggenerator-window-cpp.html
                      • qtsvg-svggenerator-window-h.html
                      • qtsvg-svgviewer-example.html
                      • qtsvg-svgviewer-exportdialog-cpp.html
                      • qtsvg-svgviewer-exportdialog-h.html
                      • qtsvg-svgviewer-files-bubbles-svg.html
                      • qtsvg-svgviewer-files-cubic-svg.html
                      • qtsvg-svgviewer-files-spheres-svg.html
                      • qtsvg-svgviewer-main-cpp.html
                      • qtsvg-svgviewer-mainwindow-cpp.html
                      • qtsvg-svgviewer-mainwindow-h.html
                      • qtsvg-svgviewer-svgview-cpp.html
                      • qtsvg-svgviewer-svgview-h.html
                      • qtsvg-svgviewer-svgviewer-pro.html
                      • qtsvg-svgviewer-svgviewer-qrc.html
                      • qtsvg.index
                      • qtsvg.qhp
                      • qtsvg.qhp.sha1
                      • qtsvg.tags
                      • qtsvglicense.html
                      • style
                        • offline-simple.css
                        • offline.css
                      • svgrendering.html
                    • qttestlib.qch
                    • qttestlib
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                      • qsignalspy-members.html
                      • qsignalspy.html
                      • qtest-obsolete.html
                      • qtest-overview.html
                      • qtest-qtoucheventsequence-members.html
                      • qtest-qtoucheventsequence.html
                      • qtest-tutorial.html
                      • qtest.html
                      • qtesteventlist-members.html
                      • qtesteventlist.html
                      • qttest-index.html
                      • qttest-module.html
                      • qttestlib-tutorial1-example.html
                      • qttestlib-tutorial1-testqstring-cpp.html
                      • qttestlib-tutorial1-tutorial1-pro.html
                      • qttestlib-tutorial2-example.html
                      • qttestlib-tutorial2-testqstring-cpp.html
                      • qttestlib-tutorial2-tutorial2-pro.html
                      • qttestlib-tutorial3-example.html
                      • qttestlib-tutorial3-testgui-cpp.html
                      • qttestlib-tutorial3-tutorial3-pro.html
                      • qttestlib-tutorial4-example.html
                      • qttestlib-tutorial4-testgui-cpp.html
                      • qttestlib-tutorial4-tutorial4-pro.html
                      • qttestlib-tutorial5-benchmarking-cpp.html
                      • qttestlib-tutorial5-example.html
                      • qttestlib-tutorial5-tutorial5-pro.html
                      • qttestlib.index
                      • qttestlib.qhp
                      • qttestlib.qhp.sha1
                      • qttestlib.tags
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtuitools.qch
                    • qtuitools
                      • examples-manifest.xml
                      • examples-qtuitools.html
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • multipleinheritance-example.png
                        • textfinder-example-find.png
                        • textfinder-example-find2.png
                        • textfinder-example-userinterface.png
                        • uitools-examples.png
                      • qtuitools-index.html
                      • qtuitools-module.html
                      • qtuitools-multipleinheritance-calculatorform-cpp.html
                      • qtuitools-multipleinheritance-calculatorform-h.html
                      • qtuitools-multipleinheritance-calculatorform-ui.html
                      • qtuitools-multipleinheritance-example.html
                      • qtuitools-multipleinheritance-main-cpp.html
                      • qtuitools-multipleinheritance-multipleinheritance-pro.html
                      • qtuitools-textfinder-example.html
                      • qtuitools-textfinder-forms-textfinder-ui.html
                      • qtuitools-textfinder-main-cpp.html
                      • qtuitools-textfinder-textfinder-cpp.html
                      • qtuitools-textfinder-textfinder-h.html
                      • qtuitools-textfinder-textfinder-pro.html
                      • qtuitools-textfinder-textfinder-qrc.html
                      • qtuitools.index
                      • qtuitools.qhp
                      • qtuitools.qhp.sha1
                      • quiloader-members.html
                      • quiloader.html
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtvirtualkeyboard.qch
                    • qtvirtualkeyboard
                      • build.html
                      • deployment-guide.html
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • basic-example.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • gesture-double-left.png
                        • gesture-double-up.png
                        • gesture-single-down-left.png
                        • gesture-single-left.png
                        • gesture-single-right.png
                        • gesture-single-up.png
                        • handwriting-mode-icon.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • language-icon.png
                        • logo.png
                      • inputframework-module.html
                      • qml-qtquick-virtualkeyboard-backspacekey-members.html
                      • qml-qtquick-virtualkeyboard-backspacekey.html
                      • qml-qtquick-virtualkeyboard-basekey-members.html
                      • qml-qtquick-virtualkeyboard-basekey.html
                      • qml-qtquick-virtualkeyboard-changelanguagekey-members.html
                      • qml-qtquick-virtualkeyboard-changelanguagekey.html
                      • qml-qtquick-virtualkeyboard-enterkey-members.html
                      • qml-qtquick-virtualkeyboard-enterkey.html
                      • qml-qtquick-virtualkeyboard-enterkeyaction-members.html
                      • qml-qtquick-virtualkeyboard-enterkeyaction.html
                      • qml-qtquick-virtualkeyboard-fillerkey-members.html
                      • qml-qtquick-virtualkeyboard-fillerkey.html
                      • qml-qtquick-virtualkeyboard-handwritinginputpanel-members.html
                      • qml-qtquick-virtualkeyboard-handwritinginputpanel.html
                      • qml-qtquick-virtualkeyboard-handwritingmodekey-members.html
                      • qml-qtquick-virtualkeyboard-handwritingmodekey.html
                      • qml-qtquick-virtualkeyboard-hidekeyboardkey-members.html
                      • qml-qtquick-virtualkeyboard-hidekeyboardkey.html
                      • qml-qtquick-virtualkeyboard-inputcontext-members.html
                      • qml-qtquick-virtualkeyboard-inputcontext.html
                      • qml-qtquick-virtualkeyboard-inputengine-members.html
                      • qml-qtquick-virtualkeyboard-inputengine.html
                      • qml-qtquick-virtualkeyboard-inputmethod-members.html
                      • qml-qtquick-virtualkeyboard-inputmethod.html
                      • qml-qtquick-virtualkeyboard-inputpanel-members.html
                      • qml-qtquick-virtualkeyboard-inputpanel.html
                      • qml-qtquick-virtualkeyboard-key-members.html
                      • qml-qtquick-virtualkeyboard-key.html
                      • qml-qtquick-virtualkeyboard-keyboardcolumn-members.html
                      • qml-qtquick-virtualkeyboard-keyboardcolumn.html
                      • qml-qtquick-virtualkeyboard-keyboardlayout-members.html
                      • qml-qtquick-virtualkeyboard-keyboardlayout.html
                      • qml-qtquick-virtualkeyboard-keyboardlayoutloader-members.html
                      • qml-qtquick-virtualkeyboard-keyboardlayoutloader.html
                      • qml-qtquick-virtualkeyboard-keyboardrow-members.html
                      • qml-qtquick-virtualkeyboard-keyboardrow.html
                      • qml-qtquick-virtualkeyboard-modekey-members.html
                      • qml-qtquick-virtualkeyboard-modekey.html
                      • qml-qtquick-virtualkeyboard-numberkey-members.html
                      • qml-qtquick-virtualkeyboard-numberkey.html
                      • qml-qtquick-virtualkeyboard-selectionlistmodel-members.html
                      • qml-qtquick-virtualkeyboard-selectionlistmodel.html
                      • qml-qtquick-virtualkeyboard-settings-virtualkeyboardsettings-members.html
                      • qml-qtquick-virtualkeyboard-settings-virtualkeyboardsettings.html
                      • qml-qtquick-virtualkeyboard-shifthandler-members.html
                      • qml-qtquick-virtualkeyboard-shifthandler.html
                      • qml-qtquick-virtualkeyboard-shiftkey-members.html
                      • qml-qtquick-virtualkeyboard-shiftkey.html
                      • qml-qtquick-virtualkeyboard-spacekey-members.html
                      • qml-qtquick-virtualkeyboard-spacekey.html
                      • qml-qtquick-virtualkeyboard-styles-keyboardstyle-members.html
                      • qml-qtquick-virtualkeyboard-styles-keyboardstyle.html
                      • qml-qtquick-virtualkeyboard-styles-keyicon-members.html
                      • qml-qtquick-virtualkeyboard-styles-keyicon.html
                      • qml-qtquick-virtualkeyboard-styles-keypanel-members.html
                      • qml-qtquick-virtualkeyboard-styles-keypanel.html
                      • qml-qtquick-virtualkeyboard-styles-selectionlistitem-members.html
                      • qml-qtquick-virtualkeyboard-styles-selectionlistitem.html
                      • qml-qtquick-virtualkeyboard-styles-tracecanvas-members.html
                      • qml-qtquick-virtualkeyboard-styles-tracecanvas.html
                      • qml-qtquick-virtualkeyboard-styles-traceinputkeypanel-members.html
                      • qml-qtquick-virtualkeyboard-styles-traceinputkeypanel.html
                      • qml-qtquick-virtualkeyboard-symbolmodekey-members.html
                      • qml-qtquick-virtualkeyboard-symbolmodekey.html
                      • qml-qtquick-virtualkeyboard-trace-members.html
                      • qml-qtquick-virtualkeyboard-trace.html
                      • qml-qtquick-virtualkeyboard-traceinputarea-members.html
                      • qml-qtquick-virtualkeyboard-traceinputarea.html
                      • qml-qtquick-virtualkeyboard-traceinputkey-members.html
                      • qml-qtquick-virtualkeyboard-traceinputkey.html
                      • qt-virtual-keyboard-qmltypes.html
                      • qtquick-virtualkeyboard-qmlmodule.html
                      • qtquick-virtualkeyboard-settings-qmlmodule.html
                      • qtquick-virtualkeyboard-styles-qmlmodule.html
                      • qtvirtualkeyboard-basic-basic-b2qt-qml.html
                      • qtvirtualkeyboard-basic-basic-pro.html
                      • qtvirtualkeyboard-basic-basic-qml.html
                      • qtvirtualkeyboard-basic-content-autoscroller-qml.html
                      • qtvirtualkeyboard-basic-content-floatingbutton-active-svg.html
                      • qtvirtualkeyboard-basic-content-floatingbutton-available-svg.html
                      • qtvirtualkeyboard-basic-content-floatingbutton-unavailable-svg.html
                      • qtvirtualkeyboard-basic-content-handwritingmodebutton-qml.html
                      • qtvirtualkeyboard-basic-content-scrollbar-qml.html
                      • qtvirtualkeyboard-basic-content-textarea-qml.html
                      • qtvirtualkeyboard-basic-content-textbase-qml.html
                      • qtvirtualkeyboard-basic-content-textfield-qml.html
                      • qtvirtualkeyboard-basic-demo-qrc.html
                      • qtvirtualkeyboard-basic-example.html
                      • qtvirtualkeyboard-basic-main-cpp.html
                      • qtvirtualkeyboard-examples.html
                      • qtvirtualkeyboard-index.html
                      • qtvirtualkeyboard-inputcontext-members.html
                      • qtvirtualkeyboard-inputcontext.html
                      • qtvirtualkeyboard-inputengine-members.html
                      • qtvirtualkeyboard-inputengine.html
                      • qtvirtualkeyboard-selectionlistmodel-members.html
                      • qtvirtualkeyboard-selectionlistmodel.html
                      • qtvirtualkeyboard-shifthandler-members.html
                      • qtvirtualkeyboard-shifthandler.html
                      • qtvirtualkeyboard-user-guide.html
                      • qtvirtualkeyboard.html
                      • qtvirtualkeyboard.index
                      • qtvirtualkeyboard.qhp
                      • qtvirtualkeyboard.qhp.sha1
                      • style
                        • offline-simple.css
                        • offline.css
                      • technical-guide.html
                    • qtwaylandcompositor.qch
                    • qtwaylandcompositor
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • used-in-examples
                          • multi-output
                            • images
                              • background.jpg
                          • pure-qml
                            • images
                              • background.jpg
                      • qml-qtwayland-compositor-shellsurfaceitem-members.html
                      • qml-qtwayland-compositor-shellsurfaceitem.html
                      • qml-qtwayland-compositor-waylandclient-members.html
                      • qml-qtwayland-compositor-waylandclient.html
                      • qml-qtwayland-compositor-waylandcompositor-members.html
                      • qml-qtwayland-compositor-waylandcompositor.html
                      • qml-qtwayland-compositor-waylandoutput-members.html
                      • qml-qtwayland-compositor-waylandoutput.html
                      • qml-qtwayland-compositor-waylandquickitem-members.html
                      • qml-qtwayland-compositor-waylandquickitem.html
                      • qml-qtwayland-compositor-waylandsurface-members.html
                      • qml-qtwayland-compositor-waylandsurface.html
                      • qml-qtwayland-compositor-waylandview-members.html
                      • qml-qtwayland-compositor-waylandview.html
                      • qml-qtwayland-compositor-wlshell-members.html
                      • qml-qtwayland-compositor-wlshell.html
                      • qml-qtwayland-compositor-wlshellsurface-members.html
                      • qml-qtwayland-compositor-wlshellsurface.html
                      • qml-qtwayland-compositor-xdgpopup-members.html
                      • qml-qtwayland-compositor-xdgpopup.html
                      • qml-qtwayland-compositor-xdgshell-members.html
                      • qml-qtwayland-compositor-xdgshell.html
                      • qml-qtwayland-compositor-xdgsurface-members.html
                      • qml-qtwayland-compositor-xdgsurface.html
                      • qtwayland-compositor-qmlmodule.html
                      • qtwaylandcompositor-examples.html
                      • qtwaylandcompositor-index.html
                      • qtwaylandcompositor-module.html
                      • qtwaylandcompositor-multi-output-example.html
                      • qtwaylandcompositor-multi-output-main-cpp.html
                      • qtwaylandcompositor-multi-output-multi-output-pro.html
                      • qtwaylandcompositor-multi-output-multi-output-qrc.html
                      • qtwaylandcompositor-multi-output-qml-gridscreen-qml.html
                      • qtwaylandcompositor-multi-output-qml-main-qml.html
                      • qtwaylandcompositor-multi-output-qml-shellchrome-qml.html
                      • qtwaylandcompositor-multi-output-qml-shellscreen-qml.html
                      • qtwaylandcompositor-pure-qml-example.html
                      • qtwaylandcompositor-pure-qml-main-cpp.html
                      • qtwaylandcompositor-pure-qml-pure-qml-pro.html
                      • qtwaylandcompositor-pure-qml-pure-qml-qrc.html
                      • qtwaylandcompositor-pure-qml-qml-chrome-qml.html
                      • qtwaylandcompositor-pure-qml-qml-keyboard-qml.html
                      • qtwaylandcompositor-pure-qml-qml-main-qml.html
                      • qtwaylandcompositor-pure-qml-qml-screen-qml.html
                      • qtwaylandcompositor-qwindow-compositor-compositor-cpp.html
                      • qtwaylandcompositor-qwindow-compositor-compositor-h.html
                      • qtwaylandcompositor-qwindow-compositor-example.html
                      • qtwaylandcompositor-qwindow-compositor-main-cpp.html
                      • qtwaylandcompositor-qwindow-compositor-qwindow-compositor-pro.html
                      • qtwaylandcompositor-qwindow-compositor-qwindow-compositor-qrc.html
                      • qtwaylandcompositor-qwindow-compositor-window-cpp.html
                      • qtwaylandcompositor-qwindow-compositor-window-h.html
                      • qtwaylandcompositor.index
                      • qtwaylandcompositor.qhp
                      • qtwaylandcompositor.qhp.sha1
                      • qwaylandbufferref-members.html
                      • qwaylandbufferref.html
                      • qwaylandclient-members.html
                      • qwaylandclient.html
                      • qwaylandcompositor-members.html
                      • qwaylandcompositor.html
                      • qwaylandinputdevice-members.html
                      • qwaylandinputdevice.html
                      • qwaylandkeyboard-members.html
                      • qwaylandkeyboard.html
                      • qwaylandoutput-members.html
                      • qwaylandoutput-mode-members.html
                      • qwaylandoutput-mode.html
                      • qwaylandoutput.html
                      • qwaylandpointer-members.html
                      • qwaylandpointer.html
                      • qwaylandquickitem-members.html
                      • qwaylandquickitem.html
                      • qwaylandquickshellsurfaceitem-members.html
                      • qwaylandquickshellsurfaceitem.html
                      • qwaylandsurface-members.html
                      • qwaylandsurface.html
                      • qwaylandsurfacegrabber-members.html
                      • qwaylandsurfacegrabber.html
                      • qwaylandtouch-members.html
                      • qwaylandtouch.html
                      • qwaylandview-members.html
                      • qwaylandview.html
                      • qwaylandwlshell-members.html
                      • qwaylandwlshell.html
                      • qwaylandwlshellsurface-members.html
                      • qwaylandwlshellsurface.html
                      • qwaylandxdgpopup-members.html
                      • qwaylandxdgpopup.html
                      • qwaylandxdgshell-members.html
                      • qwaylandxdgshell.html
                      • qwaylandxdgsurface-members.html
                      • qwaylandxdgsurface.html
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtwebchannel.qch
                    • qtwebchannel
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • chatclient-html.png
                        • chatclient-qml.png
                        • chatserver-cpp.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • standalone-screenshot.png
                      • qml-qtwebchannel-webchannel-members.html
                      • qml-qtwebchannel-webchannel.html
                      • qtwebchannel-chatclient-html-chatclient-html-pro.html
                      • qtwebchannel-chatclient-html-chatclient-html.html
                      • qtwebchannel-chatclient-html-example.html
                      • qtwebchannel-chatclient-qml-chatclient-qml-pro.html
                      • qtwebchannel-chatclient-qml-example.html
                      • qtwebchannel-chatclient-qml-qmlchatclient-qml.html
                      • qtwebchannel-chatserver-cpp-chatserver-cpp-pro.html
                      • qtwebchannel-chatserver-cpp-chatserver-cpp.html
                      • qtwebchannel-chatserver-cpp-chatserver-h.html
                      • qtwebchannel-chatserver-cpp-example.html
                      • qtwebchannel-chatserver-cpp-main-cpp.html
                      • qtwebchannel-examples.html
                      • qtwebchannel-index.html
                      • qtwebchannel-javascript.html
                      • qtwebchannel-module.html
                      • qtwebchannel-qmlmodule.html
                      • qtwebchannel-standalone-dialog-ui.html
                      • qtwebchannel-standalone-example.html
                      • qtwebchannel-standalone-index-html.html
                      • qtwebchannel-standalone-main-cpp.html
                      • qtwebchannel-standalone-standalone-pro.html
                      • qtwebchannel.index
                      • qtwebchannel.qhp
                      • qtwebchannel.qhp.sha1
                      • qtwebchannel.tags
                      • qwebchannel-members.html
                      • qwebchannel.html
                      • qwebchannelabstracttransport-members.html
                      • qwebchannelabstracttransport.html
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtwebengine.qch
                    • qtwebengine
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • browser-demo.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • contentmanipulation-example.png
                        • cookiebrowser.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • markdowneditor-example.png
                        • minimal-example.png
                        • qtwebengine-architecture.png
                        • qtwebengine-model.png
                        • qtwebenginewidgets-model.png
                        • quicknanobrowser-demo.jpg
                        • simplebrowser-model.png
                        • simplebrowser.png
                      • qml-qtwebengine-webengine-members.html
                      • qml-qtwebengine-webengine.html
                      • qml-qtwebengine-webenginecertificateerror-members.html
                      • qml-qtwebengine-webenginecertificateerror.html
                      • qml-qtwebengine-webenginecontextmenudata-members.html
                      • qml-qtwebengine-webenginecontextmenudata.html
                      • qml-qtwebengine-webenginedownloaditem-members.html
                      • qml-qtwebengine-webenginedownloaditem.html
                      • qml-qtwebengine-webenginefullscreenrequest-members.html
                      • qml-qtwebengine-webenginefullscreenrequest.html
                      • qml-qtwebengine-webenginehistory-members.html
                      • qml-qtwebengine-webenginehistory.html
                      • qml-qtwebengine-webenginehistorylistmodel-members.html
                      • qml-qtwebengine-webenginehistorylistmodel.html
                      • qml-qtwebengine-webengineloadrequest-members.html
                      • qml-qtwebengine-webengineloadrequest.html
                      • qml-qtwebengine-webenginenewviewrequest-members.html
                      • qml-qtwebengine-webenginenewviewrequest.html
                      • qml-qtwebengine-webengineprofile-members.html
                      • qml-qtwebengine-webengineprofile.html
                      • qml-qtwebengine-webenginescript-members.html
                      • qml-qtwebengine-webenginescript.html
                      • qml-qtwebengine-webenginesettings-members.html
                      • qml-qtwebengine-webenginesettings.html
                      • qml-qtwebengine-webengineview-members.html
                      • qml-qtwebengine-webengineview.html
                      • qquickwebengineprofile-members.html
                      • qquickwebengineprofile.html
                      • qtwebengine-3rdparty-almost-native-graphics-layer-engine.html
                      • qtwebengine-3rdparty-blackmagic-decklink-sdk-mac.html
                      • qtwebengine-3rdparty-boringssl.html
                      • qtwebengine-3rdparty-brotli.html
                      • qtwebengine-3rdparty-bspatch.html
                      • qtwebengine-3rdparty-chrome-custom-tabs-example-and-usage.html
                      • qtwebengine-3rdparty-chromevox.html
                      • qtwebengine-3rdparty-chromium-global.html
                      • qtwebengine-3rdparty-chromium-os-system-api.html
                      • qtwebengine-3rdparty-class-dump.html
                      • qtwebengine-3rdparty-closure-compiler.html
                      • qtwebengine-3rdparty-cocoa-extension-code-from-camino.html
                      • qtwebengine-3rdparty-compact-language-detection.html
                      • qtwebengine-3rdparty-crashpad.html
                      • qtwebengine-3rdparty-d3.html
                      • qtwebengine-3rdparty-darwin.html
                      • qtwebengine-3rdparty-david-m-gay-s-floating-point-routines.html
                      • qtwebengine-3rdparty-dom-distiller-js.html
                      • qtwebengine-3rdparty-dynamic-annotations.html
                      • qtwebengine-3rdparty-error-prone.html
                      • qtwebengine-3rdparty-expat-xml-parser.html
                      • qtwebengine-3rdparty-fdlibm.html
                      • qtwebengine-3rdparty-ffmpeg.html
                      • qtwebengine-3rdparty-fips181.html
                      • qtwebengine-3rdparty-flac.html
                      • qtwebengine-3rdparty-flot-javascript-jquery-library-for-creating-graphs.html
                      • qtwebengine-3rdparty-fontconfig.html
                      • qtwebengine-3rdparty-gifplayer-animated-gif-library.html
                      • qtwebengine-3rdparty-google-cardboard.html
                      • qtwebengine-3rdparty-google-glog-s-symbolization-library.html
                      • qtwebengine-3rdparty-google-jstemplate.html
                      • qtwebengine-3rdparty-google-safe-browsing.html
                      • qtwebengine-3rdparty-hardware-composer-plus.html
                      • qtwebengine-3rdparty-harfbuzz-ng.html
                      • qtwebengine-3rdparty-hunspell.html
                      • qtwebengine-3rdparty-iaccessible2-com-interfaces-for-accessibility.html
                      • qtwebengine-3rdparty-iccjpeg.html
                      • qtwebengine-3rdparty-icu.html
                      • qtwebengine-3rdparty-ijar.html
                      • qtwebengine-3rdparty-isimpledom-com-interfaces-for-accessibility.html
                      • qtwebengine-3rdparty-jmake.html
                      • qtwebengine-3rdparty-jsoncpp.html
                      • qtwebengine-3rdparty-khronos-header-files.html
                      • qtwebengine-3rdparty-lcov-the-ltp-gcov-extension.html
                      • qtwebengine-3rdparty-leveldb-a-fast-persistent-key-value-store.html
                      • qtwebengine-3rdparty-libevent.html
                      • qtwebengine-3rdparty-libexif.html
                      • qtwebengine-3rdparty-libjingle.html
                      • qtwebengine-3rdparty-libjpeg-turbo.html
                      • qtwebengine-3rdparty-libjpeg.html
                      • qtwebengine-3rdparty-libpng.html
                      • qtwebengine-3rdparty-libsecret.html
                      • qtwebengine-3rdparty-libsrtp.html
                      • qtwebengine-3rdparty-libudev.html
                      • qtwebengine-3rdparty-libusbx.html
                      • qtwebengine-3rdparty-libva.html
                      • qtwebengine-3rdparty-libvpx.html
                      • qtwebengine-3rdparty-libxml.html
                      • qtwebengine-3rdparty-libxslt.html
                      • qtwebengine-3rdparty-libyuv.html
                      • qtwebengine-3rdparty-linux-syscall-support.html
                      • qtwebengine-3rdparty-lzma-sdk.html
                      • qtwebengine-3rdparty-mach-override.html
                      • qtwebengine-3rdparty-mesa.html
                      • qtwebengine-3rdparty-minigbm.html
                      • qtwebengine-3rdparty-modp-base64-decoder.html
                      • qtwebengine-3rdparty-mojo.html
                      • qtwebengine-3rdparty-mt19937ar.html
                      • qtwebengine-3rdparty-netscape-plugin-application-programming-interface-npapi.html
                      • qtwebengine-3rdparty-netscape-portable-runtime-nspr.html
                      • qtwebengine-3rdparty-network-security-services-nss.html
                      • qtwebengine-3rdparty-nsbezierpath-additions-from-sean-patrick-o-brien.html
                      • qtwebengine-3rdparty-nvidia-control-x-extension-library.html
                      • qtwebengine-3rdparty-ocmock.html
                      • qtwebengine-3rdparty-open-vcdiff.html
                      • qtwebengine-3rdparty-openh264.html
                      • qtwebengine-3rdparty-openmax-dl.html
                      • qtwebengine-3rdparty-opus.html
                      • qtwebengine-3rdparty-ots-opentype-sanitizer.html
                      • qtwebengine-3rdparty-paul-hsieh-s-superfasthash.html
                      • qtwebengine-3rdparty-ply-python-lex-yacc.html
                      • qtwebengine-3rdparty-proguard.html
                      • qtwebengine-3rdparty-protocol-buffers.html
                      • qtwebengine-3rdparty-pyelftools.html
                      • qtwebengine-3rdparty-quick-color-management-system.html
                      • qtwebengine-3rdparty-re2-an-efficient-principled-regular-expression-library.html
                      • qtwebengine-3rdparty-sfntly.html
                      • qtwebengine-3rdparty-simplejson.html
                      • qtwebengine-3rdparty-skia.html
                      • qtwebengine-3rdparty-smhasher.html
                      • qtwebengine-3rdparty-snappy-a-fast-compressor-decompressor.html
                      • qtwebengine-3rdparty-speech-dispatcher.html
                      • qtwebengine-3rdparty-sqlite.html
                      • qtwebengine-3rdparty-strongtalk.html
                      • qtwebengine-3rdparty-sudden-motion-sensor-library.html
                      • qtwebengine-3rdparty-swiftshader-software-renderer.html
                      • qtwebengine-3rdparty-talloc.html
                      • qtwebengine-3rdparty-tcmalloc.html
                      • qtwebengine-3rdparty-the-usb-id-repository.html
                      • qtwebengine-3rdparty-tlslite.html
                      • qtwebengine-3rdparty-url-parse.html
                      • qtwebengine-3rdparty-usrsctp.html
                      • qtwebengine-3rdparty-v4l-utils.html
                      • qtwebengine-3rdparty-v8-javascript-engine.html
                      • qtwebengine-3rdparty-valgrind.html
                      • qtwebengine-3rdparty-wayland-protocols.html
                      • qtwebengine-3rdparty-wayland.html
                      • qtwebengine-3rdparty-web-animations-js.html
                      • qtwebengine-3rdparty-webkit.html
                      • qtwebengine-3rdparty-webm-container-parser-and-writer.html
                      • qtwebengine-3rdparty-webp-image-encoder-decoder.html
                      • qtwebengine-3rdparty-webrtc.html
                      • qtwebengine-3rdparty-windows-template-library-wtl.html
                      • qtwebengine-3rdparty-woff2.html
                      • qtwebengine-3rdparty-x86inc.html
                      • qtwebengine-3rdparty-xdg-mime.html
                      • qtwebengine-3rdparty-xdg-user-dirs.html
                      • qtwebengine-3rdparty-xdg-utils.html
                      • qtwebengine-3rdparty-yasm.html
                      • qtwebengine-3rdparty-zlib.html
                      • qtwebengine-debugging.html
                      • qtwebengine-deploying.html
                      • qtwebengine-features.html
                      • qtwebengine-index.html
                      • qtwebengine-licensing.html
                      • qtwebengine-modules.html
                      • qtwebengine-overview.html
                      • qtwebengine-platform-notes.html
                      • qtwebengine-qmlmodule.html
                      • qtwebengine-webengine-minimal-example.html
                      • qtwebengine-webengine-minimal-main-cpp.html
                      • qtwebengine-webengine-minimal-main-qml.html
                      • qtwebengine-webengine-minimal-minimal-pro.html
                      • qtwebengine-webengine-minimal-qml-qrc.html
                      • qtwebengine-webengine-quicknanobrowser-applicationroot-qml.html
                      • qtwebengine-webengine-quicknanobrowser-browserdialog-qml.html
                      • qtwebengine-webengine-quicknanobrowser-browserwindow-qml.html
                      • qtwebengine-webengine-quicknanobrowser-downloadview-qml.html
                      • qtwebengine-webengine-quicknanobrowser-example.html
                      • qtwebengine-webengine-quicknanobrowser-fullscreennotification-qml.html
                      • qtwebengine-webengine-quicknanobrowser-main-cpp.html
                      • qtwebengine-webengine-quicknanobrowser-quicknanobrowser-pro.html
                      • qtwebengine-webengine-quicknanobrowser-resources-qrc.html
                      • qtwebengine-webengine-quicknanobrowser-utils-h.html
                      • qtwebengine-webenginewidgets-contentmanipulation-contentmanipulation-pro.html
                      • qtwebengine-webenginewidgets-contentmanipulation-example.html
                      • qtwebengine-webenginewidgets-contentmanipulation-jquery-min-js.html
                      • qtwebengine-webenginewidgets-contentmanipulation-jquery-qrc.html
                      • qtwebengine-webenginewidgets-contentmanipulation-main-cpp.html
                      • qtwebengine-webenginewidgets-contentmanipulation-mainwindow-cpp.html
                      • qtwebengine-webenginewidgets-contentmanipulation-mainwindow-h.html
                      • qtwebengine-webenginewidgets-cookiebrowser-cookiebrowser-pro.html
                      • qtwebengine-webenginewidgets-cookiebrowser-cookiebrowser-qrc.html
                      • qtwebengine-webenginewidgets-cookiebrowser-cookiedialog-ui.html
                      • qtwebengine-webenginewidgets-cookiebrowser-cookiewidget-ui.html
                      • qtwebengine-webenginewidgets-cookiebrowser-example.html
                      • qtwebengine-webenginewidgets-cookiebrowser-main-cpp.html
                      • qtwebengine-webenginewidgets-cookiebrowser-mainwindow-cpp.html
                      • qtwebengine-webenginewidgets-cookiebrowser-mainwindow-h.html
                      • qtwebengine-webenginewidgets-cookiebrowser-mainwindow-ui.html
                      • qtwebengine-webenginewidgets-demobrowser-addbookmarkdialog-ui.html
                      • qtwebengine-webenginewidgets-demobrowser-autosaver-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-autosaver-h.html
                      • qtwebengine-webenginewidgets-demobrowser-bookmarks-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-bookmarks-h.html
                      • qtwebengine-webenginewidgets-demobrowser-bookmarks-ui.html
                      • qtwebengine-webenginewidgets-demobrowser-browserapplication-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-browserapplication-h.html
                      • qtwebengine-webenginewidgets-demobrowser-browsermainwindow-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-browsermainwindow-h.html
                      • qtwebengine-webenginewidgets-demobrowser-chasewidget-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-chasewidget-h.html
                      • qtwebengine-webenginewidgets-demobrowser-cookiejar-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-cookiejar-h.html
                      • qtwebengine-webenginewidgets-demobrowser-cookies-ui.html
                      • qtwebengine-webenginewidgets-demobrowser-cookiesexceptions-ui.html
                      • qtwebengine-webenginewidgets-demobrowser-data-data-qrc.html
                      • qtwebengine-webenginewidgets-demobrowser-data-demobrowser-svg.html
                      • qtwebengine-webenginewidgets-demobrowser-demobrowser-pro.html
                      • qtwebengine-webenginewidgets-demobrowser-downloaditem-ui.html
                      • qtwebengine-webenginewidgets-demobrowser-downloadmanager-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-downloadmanager-h.html
                      • qtwebengine-webenginewidgets-demobrowser-downloads-ui.html
                      • qtwebengine-webenginewidgets-demobrowser-edittableview-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-edittableview-h.html
                      • qtwebengine-webenginewidgets-demobrowser-edittreeview-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-edittreeview-h.html
                      • qtwebengine-webenginewidgets-demobrowser-example.html
                      • qtwebengine-webenginewidgets-demobrowser-featurepermissionbar-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-featurepermissionbar-h.html
                      • qtwebengine-webenginewidgets-demobrowser-fullscreennotification-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-fullscreennotification-h.html
                      • qtwebengine-webenginewidgets-demobrowser-history-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-history-h.html
                      • qtwebengine-webenginewidgets-demobrowser-history-ui.html
                      • qtwebengine-webenginewidgets-demobrowser-htmls-htmls-qrc.html
                      • qtwebengine-webenginewidgets-demobrowser-main-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-modelmenu-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-modelmenu-h.html
                      • qtwebengine-webenginewidgets-demobrowser-passworddialog-ui.html
                      • qtwebengine-webenginewidgets-demobrowser-printtopdfdialog-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-printtopdfdialog-h.html
                      • qtwebengine-webenginewidgets-demobrowser-printtopdfdialog-ui.html
                      • qtwebengine-webenginewidgets-demobrowser-proxy-ui.html
                      • qtwebengine-webenginewidgets-demobrowser-savepagedialog-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-savepagedialog-h.html
                      • qtwebengine-webenginewidgets-demobrowser-savepagedialog-ui.html
                      • qtwebengine-webenginewidgets-demobrowser-searchlineedit-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-searchlineedit-h.html
                      • qtwebengine-webenginewidgets-demobrowser-settings-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-settings-h.html
                      • qtwebengine-webenginewidgets-demobrowser-settings-ui.html
                      • qtwebengine-webenginewidgets-demobrowser-squeezelabel-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-squeezelabel-h.html
                      • qtwebengine-webenginewidgets-demobrowser-tabwidget-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-tabwidget-h.html
                      • qtwebengine-webenginewidgets-demobrowser-toolbarsearch-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-toolbarsearch-h.html
                      • qtwebengine-webenginewidgets-demobrowser-urllineedit-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-urllineedit-h.html
                      • qtwebengine-webenginewidgets-demobrowser-webview-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-webview-h.html
                      • qtwebengine-webenginewidgets-demobrowser-xbel-cpp.html
                      • qtwebengine-webenginewidgets-demobrowser-xbel-h.html
                      • qtwebengine-webenginewidgets-markdowneditor-document-cpp.html
                      • qtwebengine-webenginewidgets-markdowneditor-document-h.html
                      • qtwebengine-webenginewidgets-markdowneditor-example.html
                      • qtwebengine-webenginewidgets-markdowneditor-main-cpp.html
                      • qtwebengine-webenginewidgets-markdowneditor-mainwindow-cpp.html
                      • qtwebengine-webenginewidgets-markdowneditor-mainwindow-h.html
                      • qtwebengine-webenginewidgets-markdowneditor-mainwindow-ui.html
                      • qtwebengine-webenginewidgets-markdowneditor-markdowneditor-pro.html
                      • qtwebengine-webenginewidgets-markdowneditor-previewpage-cpp.html
                      • qtwebengine-webenginewidgets-markdowneditor-previewpage-h.html
                      • qtwebengine-webenginewidgets-markdowneditor-resources-markdown-css.html
                      • qtwebengine-webenginewidgets-markdowneditor-resources-markdowneditor-qrc.html
                      • qtwebengine-webenginewidgets-markdowneditor-resources-marked-min-js.html
                      • qtwebengine-webenginewidgets-markdowneditor-resources-qwebchannel-js.html
                      • qtwebengine-webenginewidgets-minimal-example.html
                      • qtwebengine-webenginewidgets-minimal-main-cpp.html
                      • qtwebengine-webenginewidgets-minimal-minimal-pro.html
                      • qtwebengine-webenginewidgets-simplebrowser-browser-cpp.html
                      • qtwebengine-webenginewidgets-simplebrowser-browser-h.html
                      • qtwebengine-webenginewidgets-simplebrowser-browserwindow-cpp.html
                      • qtwebengine-webenginewidgets-simplebrowser-browserwindow-h.html
                      • qtwebengine-webenginewidgets-simplebrowser-certificateerrordialog-ui.html
                      • qtwebengine-webenginewidgets-simplebrowser-data-simplebrowser-qrc.html
                      • qtwebengine-webenginewidgets-simplebrowser-data-simplebrowser-svg.html
                      • qtwebengine-webenginewidgets-simplebrowser-example.html
                      • qtwebengine-webenginewidgets-simplebrowser-main-cpp.html
                      • qtwebengine-webenginewidgets-simplebrowser-passworddialog-ui.html
                      • qtwebengine-webenginewidgets-simplebrowser-simplebrowser-pro.html
                      • qtwebengine-webenginewidgets-simplebrowser-tabwidget-cpp.html
                      • qtwebengine-webenginewidgets-simplebrowser-tabwidget-h.html
                      • qtwebengine-webenginewidgets-simplebrowser-urllineedit-cpp.html
                      • qtwebengine-webenginewidgets-simplebrowser-urllineedit-h.html
                      • qtwebengine-webenginewidgets-simplebrowser-webpage-cpp.html
                      • qtwebengine-webenginewidgets-simplebrowser-webpage-h.html
                      • qtwebengine-webenginewidgets-simplebrowser-webpopupwindow-cpp.html
                      • qtwebengine-webenginewidgets-simplebrowser-webpopupwindow-h.html
                      • qtwebengine-webenginewidgets-simplebrowser-webview-cpp.html
                      • qtwebengine-webenginewidgets-simplebrowser-webview-h.html
                      • qtwebengine.html
                      • qtwebengine.index
                      • qtwebengine.qhp
                      • qtwebengine.qhp.sha1
                      • qtwebengine.tags
                      • qtwebenginecore-index.html
                      • qtwebenginecore-module.html
                      • qtwebenginewidgets-index.html
                      • qtwebenginewidgets-module.html
                      • qtwebenginewidgets-qtwebkitportingguide.html
                      • qwebenginecertificateerror-members.html
                      • qwebenginecertificateerror.html
                      • qwebenginecontextmenudata-members.html
                      • qwebenginecontextmenudata.html
                      • qwebenginecookiestore-members.html
                      • qwebenginecookiestore.html
                      • qwebenginedownloaditem-members.html
                      • qwebenginedownloaditem.html
                      • qwebenginefullscreenrequest-members.html
                      • qwebenginefullscreenrequest.html
                      • qwebenginehistory-members.html
                      • qwebenginehistory.html
                      • qwebenginehistoryitem-members.html
                      • qwebenginehistoryitem.html
                      • qwebenginepage-members.html
                      • qwebenginepage.html
                      • qwebengineprofile-members.html
                      • qwebengineprofile.html
                      • qwebenginescript-members.html
                      • qwebenginescript.html
                      • qwebenginescriptcollection-members.html
                      • qwebenginescriptcollection.html
                      • qwebenginesettings-members.html
                      • qwebenginesettings.html
                      • qwebengineurlrequestinfo-members.html
                      • qwebengineurlrequestinfo.html
                      • qwebengineurlrequestinterceptor-members.html
                      • qwebengineurlrequestinterceptor.html
                      • qwebengineurlrequestjob-members.html
                      • qwebengineurlrequestjob.html
                      • qwebengineurlschemehandler-members.html
                      • qwebengineurlschemehandler.html
                      • qwebengineview-members.html
                      • qwebengineview.html
                      • style
                        • offline-simple.css
                        • offline.css
                      • webengine-examples.html
                      • webengine-widgetexamples.html
                    • qtwebsockets.qch
                    • qtwebsockets
                      • echoclient.html
                      • echoserver.html
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • echoclient-html-example.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • websockets-pictorial-representation.jpg
                      • qmaskgenerator-members.html
                      • qmaskgenerator.html
                      • qml-qtwebsockets-websocket-members.html
                      • qml-qtwebsockets-websocket.html
                      • qml-qtwebsockets-websocketserver-members.html
                      • qml-qtwebsockets-websocketserver.html
                      • qtwebsockets-echoclient-echoclient-cpp.html
                      • qtwebsockets-echoclient-echoclient-h.html
                      • qtwebsockets-echoclient-echoclient-pro.html
                      • qtwebsockets-echoclient-example.html
                      • qtwebsockets-echoclient-main-cpp.html
                      • qtwebsockets-echoserver-echoclient-html.html
                      • qtwebsockets-echoserver-echoserver-cpp.html
                      • qtwebsockets-echoserver-echoserver-h.html
                      • qtwebsockets-echoserver-echoserver-pro.html
                      • qtwebsockets-echoserver-example.html
                      • qtwebsockets-echoserver-main-cpp.html
                      • qtwebsockets-examples.html
                      • qtwebsockets-index.html
                      • qtwebsockets-module.html
                      • qtwebsockets-qmlmodule.html
                      • qtwebsockets-qmlwebsocketclient-data-qrc.html
                      • qtwebsockets-qmlwebsocketclient-example.html
                      • qtwebsockets-qmlwebsocketclient-main-cpp.html
                      • qtwebsockets-qmlwebsocketclient-qml-qmlwebsocketclient-main-qml.html
                      • qtwebsockets-qmlwebsocketclient-qmlwebsocketclient-pro.html
                      • qtwebsockets-qmlwebsocketserver-data-qrc.html
                      • qtwebsockets-qmlwebsocketserver-example.html
                      • qtwebsockets-qmlwebsocketserver-main-cpp.html
                      • qtwebsockets-qmlwebsocketserver-qml-qmlwebsocketserver-main-qml.html
                      • qtwebsockets-qmlwebsocketserver-qmlwebsocketserver-pro.html
                      • qtwebsockets-simplechat-chatclient-html.html
                      • qtwebsockets-simplechat-chatserver-cpp.html
                      • qtwebsockets-simplechat-chatserver-h.html
                      • qtwebsockets-simplechat-example.html
                      • qtwebsockets-simplechat-main-cpp.html
                      • qtwebsockets-simplechat-simplechat-pro.html
                      • qtwebsockets-sslechoclient-example.html
                      • qtwebsockets-sslechoclient-main-cpp.html
                      • qtwebsockets-sslechoclient-sslechoclient-cpp.html
                      • qtwebsockets-sslechoclient-sslechoclient-h.html
                      • qtwebsockets-sslechoclient-sslechoclient-pro.html
                      • qtwebsockets-sslechoserver-example.html
                      • qtwebsockets-sslechoserver-main-cpp.html
                      • qtwebsockets-sslechoserver-securesocketclient-qrc.html
                      • qtwebsockets-sslechoserver-sslechoclient-html.html
                      • qtwebsockets-sslechoserver-sslechoserver-cpp.html
                      • qtwebsockets-sslechoserver-sslechoserver-h.html
                      • qtwebsockets-sslechoserver-sslechoserver-pro.html
                      • qtwebsockets-testing.html
                      • qtwebsockets.index
                      • qtwebsockets.qhp
                      • qtwebsockets.qhp.sha1
                      • qtwebsockets.tags
                      • qwebsocket-members.html
                      • qwebsocket.html
                      • qwebsocketcorsauthenticator-members.html
                      • qwebsocketcorsauthenticator.html
                      • qwebsocketprotocol.html
                      • qwebsocketserver-members.html
                      • qwebsocketserver.html
                      • style
                        • offline-simple.css
                        • offline.css
                      • websockets-overview.html
                    • qtwebview.qch
                    • qtwebview
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • used-in-examples
                          • minibrowser
                            • images
                              • left-32.png
                              • refresh-32.png
                              • right-32.png
                              • stop-32.png
                        • webview-example.jpg
                      • qml-qtwebview-webview-members.html
                      • qml-qtwebview-webview.html
                      • qml-qtwebview-webviewloadrequest-members.html
                      • qml-qtwebview-webviewloadrequest.html
                      • qtwebview-examples.html
                      • qtwebview-index.html
                      • qtwebview-minibrowser-android-loadprogressstyle-qml.html
                      • qtwebview-minibrowser-example.html
                      • qtwebview-minibrowser-loadprogressstyle-qml.html
                      • qtwebview-minibrowser-main-cpp.html
                      • qtwebview-minibrowser-main-qml.html
                      • qtwebview-minibrowser-minibrowser-pro.html
                      • qtwebview-minibrowser-qml-qrc.html
                      • qtwebview-module.html
                      • qtwebview-qmlmodule.html
                      • qtwebview.html
                      • qtwebview.index
                      • qtwebview.qhp
                      • qtwebview.qhp.sha1
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtwidgets.qch
                    • qtwidgets
                      • application-windows.html
                      • dialogs.html
                      • examples-desktop.html
                      • examples-dialogs.html
                      • examples-graphicsview.html
                      • examples-itemviews.html
                      • examples-mainwindow.html
                      • examples-manifest.xml
                      • examples-painting.html
                      • examples-richtext.html
                      • examples-widgets.html
                      • focus.html
                      • gallery-fusion.html
                      • gallery-macintosh.html
                      • gallery-windows.html
                      • gallery-windowsvista.html
                      • gallery-windowsxp.html
                      • gallery.html
                      • gestures-overview.html
                      • graphicsview.html
                      • guibooks.html
                      • images
                        • addressbook-adddialog.png
                        • addressbook-classes.png
                        • addressbook-editdialog.png
                        • addressbook-example.png
                        • addressbook-filemenu.png
                        • addressbook-newaddresstab.png
                        • addressbook-signals.png
                        • addressbook-toolsmenu.png
                        • addressbook-tutorial-part1-labeled-layout.png
                        • addressbook-tutorial-part1-labeled-screenshot.png
                        • addressbook-tutorial-part1-screenshot.png
                        • addressbook-tutorial-part2-add-contact.png
                        • addressbook-tutorial-part2-add-flowchart.png
                        • addressbook-tutorial-part2-add-successful.png
                        • addressbook-tutorial-part2-labeled-layout.png
                        • addressbook-tutorial-part2-signals-and-slots.png
                        • addressbook-tutorial-part2-stretch-effects.png
                        • addressbook-tutorial-part3-labeled-layout.png
                        • addressbook-tutorial-part3-linkedlist.png
                        • addressbook-tutorial-part3-screenshot.png
                        • addressbook-tutorial-part4-remove.png
                        • addressbook-tutorial-part5-finddialog.png
                        • addressbook-tutorial-part5-notfound.png
                        • addressbook-tutorial-part5-screenshot.png
                        • addressbook-tutorial-part5-signals-and-slots.png
                        • addressbook-tutorial-part6-load.png
                        • addressbook-tutorial-part6-save.png
                        • addressbook-tutorial-part6-screenshot.png
                        • addressbook-tutorial-part7-screenshot.png
                        • addressbook-tutorial-screenshot.png
                        • affine-demo.png
                        • analogclock-example.png
                        • analogclock-viewport.png
                        • animatedtiles-example.png
                        • appchooser-example.png
                        • application-menus.png
                        • application.png
                        • arrow_bc.png
                        • assistant-toolbar.png
                        • basicdrawing-example.png
                        • basicgraphicslayouts-example.png
                        • basiclayouts-example.png
                        • basicsortfiltermodel-example.png
                        • bgrContent.png
                        • blurpickereffect-example.png
                        • borderlayout-example.png
                        • boxes-demo.png
                        • branchindicatorimage.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • button.png
                        • buttonbox-gnomelayout-horizontal.png
                        • buttonbox-gnomelayout-vertical.png
                        • buttonbox-kdelayout-horizontal.png
                        • buttonbox-kdelayout-vertical.png
                        • buttonbox-mac-modeless-horizontal.png
                        • buttonbox-mac-modeless-vertical.png
                        • buttonbox-maclayout-horizontal.png
                        • buttonbox-maclayout-vertical.png
                        • buttonbox-winlayout-horizontal.png
                        • buttonbox-winlayout-vertical.png
                        • calculator-example.png
                        • calculator-ugly.png
                        • calendar-example.png
                        • calendarwidgetexample.png
                        • charactermap-example.png
                        • chart-example.png
                        • checkbox.png
                        • checkboxes-exclusive.png
                        • checkboxes-non-exclusive.png
                        • checkboxexample.png
                        • chip-demo.png
                        • classwizard-flow.png
                        • classwizard.png
                        • clock.png
                        • codecs-example.png
                        • codeeditor-example.png
                        • collidingmice-example.png
                        • coloreditorfactoryimage.png
                        • columnview.png
                        • combobox.png
                        • comboboximage.png
                        • combowidgetmapper-example.png
                        • completer-example-country.png
                        • completer-example-dirmodel.png
                        • completer-example-qdirmodel.png
                        • completer-example-word.png
                        • completer-example.png
                        • composition-demo.png
                        • concentriccircles-example.png
                        • conceptualpushbuttontree.png
                        • configdialog-example.png
                        • customcompleter-example.png
                        • customcompleter-insertcompletion.png
                        • customsortfiltermodel-example.png
                        • deform-demo.png
                        • designer-stylesheet-options.png
                        • designer-stylesheet-usage.png
                        • designer-validator-highlighter.png
                        • desktop-examples.png
                        • diagramscene.png
                        • dialog-examples.png
                        • digitalclock-example.png
                        • dirview-example.png
                        • dockwidget.png
                        • dockwidgetimage.png
                        • dockwidgets-example.png
                        • draganddroppuzzle-example.png
                        • dragdroprobot-example.png
                        • draggableicons-example.png
                        • draggabletext-example.png
                        • dropsite-example.png
                        • dummy_tree.png
                        • easing-example.png
                        • echopluginexample.png
                        • elasticnodes-example.png
                        • elidedlabel-example.png
                        • embeddeddialogs-demo.png
                        • example_model.png
                        • extension-example.png
                        • extension_more.png
                        • factorial-example.png
                        • fademessageeffect-example-faded.png
                        • fademessageeffect-example.png
                        • fetchmore-example.png
                        • filedialogurls.png
                        • findfiles-example.png
                        • findfiles_progress_dialog.png
                        • flowlayout-example.png
                        • fontsampler-example.png
                        • frames.png
                        • fridgemagnets-example.png
                        • frozencolumn-example.png
                        • frozencolumn-tableview.png
                        • fusion-calendarwidget.png
                        • fusion-checkbox.png
                        • fusion-colordialog.png
                        • fusion-combobox.png
                        • fusion-dateedit.png
                        • fusion-datetimeedit.png
                        • fusion-dial.png
                        • fusion-doublespinbox.png
                        • fusion-fontcombobox.png
                        • fusion-fontdialog.png
                        • fusion-frame.png
                        • fusion-groupbox.png
                        • fusion-horizontalscrollbar.png
                        • fusion-label.png
                        • fusion-lcdnumber.png
                        • fusion-lineedit.png
                        • fusion-listview.png
                        • fusion-menu.png
                        • fusion-progressbar.png
                        • fusion-progressdialog.png
                        • fusion-pushbutton-menu.png
                        • fusion-pushbutton.png
                        • fusion-radiobutton.png
                        • fusion-slider.png
                        • fusion-spinbox.png
                        • fusion-statusbar-sizegrip.png
                        • fusion-tabbar-truncated.png
                        • fusion-tabbar.png
                        • fusion-tableview.png
                        • fusion-tabwidget.png
                        • fusion-textedit.png
                        • fusion-timeedit.png
                        • fusion-toolbox.png
                        • fusion-toolbutton.png
                        • fusion-treeview.png
                        • geometry.png
                        • gradients-demo.png
                        • graphicsanchorlayout-example.png
                        • graphicseffect-blur.png
                        • graphicseffect-colorize.png
                        • graphicseffect-drop-shadow.png
                        • graphicseffect-opacity.png
                        • graphicseffect-plain.png
                        • graphicseffect-widget.png
                        • graphicsflowlayout-example.png
                        • graphicssimpleanchorlayout-example.png
                        • graphicsview-ellipseitem-pie.png
                        • graphicsview-ellipseitem.png
                        • graphicsview-examples.png
                        • graphicsview-items.png
                        • graphicsview-lineitem.png
                        • graphicsview-parentchild.png
                        • graphicsview-pathitem.png
                        • graphicsview-pixmapitem.png
                        • graphicsview-polygonitem.png
                        • graphicsview-rectitem.png
                        • graphicsview-simpletextitem.png
                        • graphicsview-textitem.png
                        • graphicsview-view.png
                        • graphicsview-zorder.png
                        • gridlayout.png
                        • groupbox-example.png
                        • groupbox.png
                        • groupboximage.png
                        • header.png
                        • headerimage.png
                        • home.png
                        • i18n-example.png
                        • icons-example.png
                        • icons-view-menu.png
                        • icons_find_normal.png
                        • icons_find_normal_disabled.png
                        • icons_images_groupbox.png
                        • icons_monkey.png
                        • icons_monkey_active.png
                        • icons_monkey_mess.png
                        • icons_preview_area.png
                        • icons_qt_extended_16x16.png
                        • icons_qt_extended_17x17.png
                        • icons_qt_extended_32x32.png
                        • icons_qt_extended_33x33.png
                        • icons_qt_extended_48x48.png
                        • icons_qt_extended_64x64.png
                        • icons_qt_extended_8x8.png
                        • icons_size_groupbox.png
                        • icons_size_spinbox.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • imagecomposition-example.png
                        • imagegestures-example.jpg
                        • imageviewer-example.png
                        • imageviewer-fit_to_window_1.png
                        • imageviewer-fit_to_window_2.png
                        • imageviewer-original_size.png
                        • imageviewer-zoom_in_1.png
                        • imageviewer-zoom_in_2.png
                        • inputdialogs.png
                        • interview-demo.png
                        • itemviews-editabletreemodel-indexes.png
                        • itemviews-editabletreemodel-items.png
                        • itemviews-editabletreemodel-model.png
                        • itemviews-editabletreemodel-values.png
                        • itemviews-editabletreemodel.png
                        • itemviews-examples.png
                        • itemviewspuzzle-example.png
                        • layout1.png
                        • layout2.png
                        • licensewizard-example.png
                        • licensewizard-flow.png
                        • lightingeffect-example.png
                        • lineedits-example.png
                        • listview.png
                        • list_table_tree.png
                        • logo.png
                        • macintosh-calendarwidget.png
                        • macintosh-checkbox.png
                        • macintosh-combobox.png
                        • macintosh-dateedit.png
                        • macintosh-datetimeedit.png
                        • macintosh-dial.png
                        • macintosh-doublespinbox.png
                        • macintosh-fontcombobox.png
                        • macintosh-frame.png
                        • macintosh-groupbox.png
                        • macintosh-horizontalscrollbar.png
                        • macintosh-label.png
                        • macintosh-lcdnumber.png
                        • macintosh-lineedit.png
                        • macintosh-listview.png
                        • macintosh-menu.png
                        • macintosh-progressbar.png
                        • macintosh-pushbutton.png
                        • macintosh-radiobutton.png
                        • macintosh-slider.png
                        • macintosh-spinbox.png
                        • macintosh-tableview.png
                        • macintosh-tabwidget.png
                        • macintosh-textedit.png
                        • macintosh-timeedit.png
                        • macintosh-toolbox.png
                        • macintosh-toolbutton.png
                        • macintosh-treeview.png
                        • mainwindow-demo.png
                        • mainwindow-docks-example.png
                        • mainwindow-docks.png
                        • mainwindow-examples.png
                        • mainwindowlayout.png
                        • mdi-cascade.png
                        • mdi-example.png
                        • mdi-tile.png
                        • menu.png
                        • menubar.png
                        • menubarimage.png
                        • menuimage.png
                        • menus-example.png
                        • modelview-combobox.png
                        • modelview-header.png
                        • modelview-models.png
                        • modelview-overview.png
                        • modelview-roles.png
                        • modelview-tablemodel.png
                        • modelview-treemodel.png
                        • modelview.png
                        • mousebutton-buttontester.png
                        • move-blocks-chart.png
                        • moveblocks-example.png
                        • movie-example.png
                        • msgbox1.png
                        • msgbox2.png
                        • msgbox3.png
                        • msgbox4.png
                        • orderform-example-detailsdialog.png
                        • orderform-example.png
                        • padnavigator-example.png
                        • painterpaths-example.png
                        • painting-examples.png
                        • paintsystem-icon.png
                        • paintsystem-stylepainter.png
                        • pangesture.png
                        • parent-child-widgets.png
                        • pathstroke-demo.png
                        • pinchgesture.png
                        • pingpong-example.png
                        • pixelator-example.png
                        • plugandpaint-plugindialog.png
                        • plugandpaint.png
                        • progressBar-stylesheet.png
                        • progressbar.png
                        • progressBar2-stylesheet.png
                        • progressbarimage.png
                        • propagation-custom.png
                        • propagation-standard.png
                        • pushbutton.png
                        • qactiongroup-align.png
                        • qcalendarwidget-grid.png
                        • qcalendarwidget-maximum.png
                        • qcalendarwidget-minimum.png
                        • qcolumnview.png
                        • qcompleter.png
                        • qdesktopwidget.png
                        • qerrormessage.png
                        • qformlayout-kde.png
                        • qformlayout-mac.png
                        • qformlayout-qpe.png
                        • qformlayout-win.png
                        • qformlayout-with-6-children.png
                        • qgraphicsproxywidget-embed.png
                        • qgridlayout-with-5-children.png
                        • qhboxlayout-with-5-children.png
                        • qmdisubwindowlayout.png
                        • qmessagebox-crit.png
                        • qmessagebox-info.png
                        • qmessagebox-quest.png
                        • qmessagebox-warn.png
                        • qscrollarea-noscrollbars.png
                        • qscrollarea-onescrollbar.png
                        • qscrollarea-twoscrollbars.png
                        • qscrollbar-picture.png
                        • qscrollbar-values.png
                        • qspinbox-plusminus.png
                        • qspinbox-updown.png
                        • qstyle-comboboxes.png
                        • qstyleoptiontoolbar-position.png
                        • qtableview-resized.png
                        • qtwizard-aero1.png
                        • qtwizard-aero2.png
                        • qtwizard-classic1.png
                        • qtwizard-classic2.png
                        • qtwizard-mac1.png
                        • qtwizard-mac2.png
                        • qtwizard-macpage.png
                        • qtwizard-modern1.png
                        • qtwizard-modern2.png
                        • qtwizard-nonmacpage.png
                        • qundoview.png
                        • qvboxlayout-with-5-children.png
                        • readonlytable_role.png
                        • regexp-example.png
                        • regularexpression-example.png
                        • richtext-examples.png
                        • rogue-example.png
                        • rogue-statechart.png
                        • rubberband.png
                        • rubberbandimage.png
                        • screenshot-example.png
                        • scribble-example.png
                        • scrollbar.png
                        • scrollbarimage.png
                        • sdi-example.png
                        • selected-items1.png
                        • selected-items2.png
                        • selected-items3.png
                        • selection-extended.png
                        • selection-multi.png
                        • selection-single.png
                        • selection2.png
                        • settingseditor-example.png
                        • shapedclock-dragging.png
                        • shapedclock-example.png
                        • shareddirmodel.png
                        • sharedmodel-tableviews.png
                        • sharedselection-tableviews.png
                        • signals-n-slots-aw-nat.png
                        • simpleanchorlayout-example.png
                        • simpledommodel-example.png
                        • simpletreemodel-example.png
                        • simplewidgetmapper-example.png
                        • sipdialog-closed.png
                        • sipdialog-opened.png
                        • sizegrip.png
                        • sizegripimage.png
                        • slider.png
                        • sliderimage.png
                        • sliders-example.png
                        • spinbox.png
                        • spinboxdelegate-example.png
                        • spinboxes-example.png
                        • spinboximage.png
                        • spreadsheet-demo.png
                        • standard-views.png
                        • standarddialogs-example.png
                        • standardwidget.png
                        • stardelegate.png
                        • states-example.png
                        • stickman-example.png
                        • stickman-example1.png
                        • stickman-example2.png
                        • stickman-example3.png
                        • stringlistmodel.png
                        • stylepluginexample.png
                        • styles-3d.png
                        • styles-aliasing.png
                        • styles-disabledwood.png
                        • styles-enabledwood.png
                        • styles-woodbuttons.png
                        • stylesheet-border-image-normal.png
                        • stylesheet-border-image-stretched.png
                        • stylesheet-border-image-wrong.png
                        • stylesheet-boxmodel.png
                        • stylesheet-branch-closed.png
                        • stylesheet-branch-end.png
                        • stylesheet-branch-more.png
                        • stylesheet-branch-open.png
                        • stylesheet-coffee-cleanlooks.png
                        • stylesheet-coffee-xp.png
                        • stylesheet-pagefold-mac.png
                        • stylesheet-pagefold.png
                        • stylesheet-redbutton1.png
                        • stylesheet-redbutton2.png
                        • stylesheet-redbutton3.png
                        • stylesheet-scrollbar1.png
                        • stylesheet-scrollbar2.png
                        • stylesheet-treeview.png
                        • stylesheet-vline.png
                        • sub-attaq-demo.png
                        • swipegesture.png
                        • syntaxhighlighter-example.png
                        • system-tray.png
                        • systemtray-editor.png
                        • systemtray-example.png
                        • tab.png
                        • tabdialog-example.png
                        • tabletexample.png
                        • tableview.png
                        • tableWidget-stylesheet.png
                        • tabWidget-stylesheet1.png
                        • tabWidget-stylesheet2.png
                        • tabWidget-stylesheet3.png
                        • tabwidget.png
                        • tetrix-example.png
                        • textedit-demo.png
                        • titlebar.png
                        • titlebarimage.png
                        • toolbar.png
                        • toolbarimage.png
                        • toolbox.png
                        • toolboximage.png
                        • toolbutton.png
                        • toolbuttonimage.png
                        • tooltips-example.png
                        • trafficlight-example.png
                        • trafficlight-example1.png
                        • trafficlight-example2.png
                        • transformations-example.png
                        • treemodel-structure.png
                        • treemodelcompleter-example.png
                        • treeview.png
                        • tree_2_with_algorithm.png
                        • trivialwizard-example-conclusion.png
                        • trivialwizard-example-flow.png
                        • trivialwizard-example-introduction.png
                        • trivialwizard-example-registration.png
                        • undodemo.png
                        • undoframeworkexample.png
                        • used-in-examples
                          • animation
                            • animatedtiles
                              • images
                                • centered.png
                                • ellipse.png
                                • figure8.png
                                • kinetic.png
                                • random.png
                                • tile.png
                                • Time-For-Lunch-2.jpg
                            • easing
                              • images
                                • qt-logo.png
                          • desktop
                            • systray
                              • images
                                • bad.png
                                • heart.png
                                • trash.png
                          • dialogs
                            • classwizard
                              • images
                                • background.png
                                • banner.png
                                • logo1.png
                                • logo2.png
                                • logo3.png
                                • watermark1.png
                                • watermark2.png
                            • configdialog
                              • images
                                • config.png
                                • query.png
                                • update.png
                            • licensewizard
                              • images
                                • logo.png
                                • watermark.png
                          • draganddrop
                            • draggableicons
                              • images
                                • boat.png
                                • car.png
                                • house.png
                          • effects
                            • blurpicker
                              • images
                                • accessories-calculator.png
                                • accessories-text-editor.png
                                • background.jpg
                                • help-browser.png
                                • internet-group-chat.png
                                • internet-mail.png
                                • internet-web-browser.png
                                • office-calendar.png
                                • system-users.png
                          • graphicsview
                            • basicgraphicslayouts
                              • images
                                • block.png
                            • collidingmice
                              • images
                                • cheese.jpg
                            • diagramscene
                              • images
                                • background1.png
                                • background2.png
                                • background3.png
                                • background4.png
                                • bold.png
                                • bringtofront.png
                                • delete.png
                                • floodfill.png
                                • italic.png
                                • linecolor.png
                                • linepointer.png
                                • pointer.png
                                • sendtoback.png
                                • textpointer.png
                                • underline.png
                            • dragdroprobot
                              • images
                                • head.png
                            • padnavigator
                              • images
                                • artsfftscope.png
                                • blue_angle_swirl.jpg
                                • kontact_contacts.png
                                • kontact_journal.png
                                • kontact_mail.png
                                • kontact_notes.png
                                • kopeteavailable.png
                                • metacontact_online.png
                                • minitools.png
                            • weatheranchorlayout
                              • images
                                • 5days.jpg
                                • details.jpg
                                • place.jpg
                                • tabbar.jpg
                                • title.jpg
                                • weather-few-clouds.png
                          • itemviews
                            • customsortfiltermodel
                              • images
                                • find.png
                            • interview
                              • images
                                • folder.png
                                • interview.png
                                • services.png
                            • pixelator
                              • images
                                • qt.png
                            • spreadsheet
                              • images
                                • interview.png
                          • mainwindows
                            • application
                              • images
                                • copy.png
                                • cut.png
                                • new.png
                                • open.png
                                • paste.png
                                • save.png
                            • dockwidgets
                              • images
                                • new.png
                                • print.png
                                • save.png
                                • undo.png
                            • mdi
                              • images
                                • copy.png
                                • cut.png
                                • new.png
                                • open.png
                                • paste.png
                                • save.png
                            • sdi
                              • images
                                • copy.png
                                • cut.png
                                • new.png
                                • open.png
                                • paste.png
                                • save.png
                          • painting
                            • basicdrawing
                              • images
                                • brick.png
                                • qt-logo.png
                            • imagecomposition
                              • images
                                • background.png
                                • blackrectangle.png
                                • butterfly.png
                                • checker.png
                          • richtext
                            • textedit
                              • images
                                • logo32.png
                                • mac
                                  • editcopy.png
                                  • editcut.png
                                  • editpaste.png
                                  • editredo.png
                                  • editundo.png
                                  • exportpdf.png
                                  • filenew.png
                                  • fileopen.png
                                  • fileprint.png
                                  • filesave.png
                                  • textbold.png
                                  • textcenter.png
                                  • textitalic.png
                                  • textjustify.png
                                  • textleft.png
                                  • textright.png
                                  • textunder.png
                                  • zoomin.png
                                  • zoomout.png
                                • win
                                  • editcopy.png
                                  • editcut.png
                                  • editpaste.png
                                  • editredo.png
                                  • editundo.png
                                  • exportpdf.png
                                  • filenew.png
                                  • fileopen.png
                                  • fileprint.png
                                  • filesave.png
                                  • textbold.png
                                  • textcenter.png
                                  • textitalic.png
                                  • textjustify.png
                                  • textleft.png
                                  • textright.png
                                  • textunder.png
                                  • zoomin.png
                                  • zoomout.png
                          • tools
                            • regularexpression
                              • images
                                • copy.png
                            • undoframework
                              • images
                                • cross.png
                          • widgets
                            • icons
                              • images
                                • designer.png
                                • find_disabled.png
                                • find_normal.png
                                • monkey_off_128x128.png
                                • monkey_off_16x16.png
                                • monkey_off_32x32.png
                                • monkey_off_64x64.png
                                • monkey_on_128x128.png
                                • monkey_on_16x16.png
                                • monkey_on_32x32.png
                                • monkey_on_64x64.png
                                • qt_extended_16x16.png
                                • qt_extended_32x32.png
                                • qt_extended_48x48.png
                            • styles
                              • images
                                • woodbackground.png
                                • woodbutton.png
                            • stylesheet
                              • images
                                • checkbox_checked.png
                                • checkbox_checked_hover.png
                                • checkbox_checked_pressed.png
                                • checkbox_unchecked.png
                                • checkbox_unchecked_hover.png
                                • checkbox_unchecked_pressed.png
                                • down_arrow.png
                                • down_arrow_disabled.png
                                • frame.png
                                • pagefold.png
                                • pushbutton.png
                                • pushbutton_hover.png
                                • pushbutton_pressed.png
                                • radiobutton_checked.png
                                • radiobutton_checked_hover.png
                                • radiobutton_checked_pressed.png
                                • radiobutton_unchecked.png
                                • radiobutton_unchecked_hover.png
                                • radiobutton_unchecked_pressed.png
                                • sizegrip.png
                                • spindown.png
                                • spindown_hover.png
                                • spindown_off.png
                                • spindown_pressed.png
                                • spinup.png
                                • spinup_hover.png
                                • spinup_off.png
                                • spinup_pressed.png
                                • up_arrow.png
                                • up_arrow_disabled.png
                            • tablet
                              • images
                                • cursor-airbrush.png
                                • cursor-eraser.png
                                • cursor-felt-marker.png
                                • cursor-pencil.png
                            • tooltips
                              • images
                                • circle.png
                                • square.png
                                • triangle.png
                        • weatheranchorlayout-example.png
                        • whatsthis.png
                        • widget-examples.png
                        • widgetdelegate.png
                        • widgetmapper-combo-mapping.png
                        • widgetmapper-simple-mapping.png
                        • widgetmapper.png
                        • widgets-tutorial-childwidget.png
                        • widgets-tutorial-nestedlayouts.png
                        • widgets-tutorial-toplevel.png
                        • widgets-tutorial-windowlayout.png
                        • wiggly-example.png
                        • windowflags-example.png
                        • windowflags_controllerwindow.png
                        • windowflags_previewwindow.png
                        • windows-calendarwidget.png
                        • windows-checkbox.png
                        • windows-combobox.png
                        • windows-dateedit.png
                        • windows-datetimeedit.png
                        • windows-dial.png
                        • windows-doublespinbox.png
                        • windows-fontcombobox.png
                        • windows-frame.png
                        • windows-groupbox.png
                        • windows-horizontalscrollbar.png
                        • windows-label.png
                        • windows-lcdnumber.png
                        • windows-lineedit.png
                        • windows-listview.png
                        • windows-progressbar.png
                        • windows-pushbutton.png
                        • windows-radiobutton.png
                        • windows-slider.png
                        • windows-spinbox.png
                        • windows-tableview.png
                        • windows-tabwidget.png
                        • windows-textedit.png
                        • windows-timeedit.png
                        • windows-toolbox.png
                        • windows-toolbutton.png
                        • windows-treeview.png
                        • windowstabimage.png
                        • windowsvista-calendarwidget.png
                        • windowsvista-checkbox.png
                        • windowsvista-combobox.png
                        • windowsvista-dateedit.png
                        • windowsvista-datetimeedit.png
                        • windowsvista-dial.png
                        • windowsvista-doublespinbox.png
                        • windowsvista-fontcombobox.png
                        • windowsvista-frame.png
                        • windowsvista-groupbox.png
                        • windowsvista-horizontalscrollbar.png
                        • windowsvista-label.png
                        • windowsvista-lcdnumber.png
                        • windowsvista-lineedit.png
                        • windowsvista-listview.png
                        • windowsvista-progressbar.png
                        • windowsvista-pushbutton.png
                        • windowsvista-radiobutton.png
                        • windowsvista-slider.png
                        • windowsvista-spinbox.png
                        • windowsvista-tableview.png
                        • windowsvista-tabwidget.png
                        • windowsvista-textedit.png
                        • windowsvista-timeedit.png
                        • windowsvista-toolbox.png
                        • windowsvista-toolbutton.png
                        • windowsvista-treeview.png
                        • windowsxp-calendarwidget.png
                        • windowsxp-checkbox.png
                        • windowsxp-combobox.png
                        • windowsxp-dateedit.png
                        • windowsxp-datetimeedit.png
                        • windowsxp-dial.png
                        • windowsxp-doublespinbox.png
                        • windowsxp-fontcombobox.png
                        • windowsxp-frame.png
                        • windowsxp-groupbox.png
                        • windowsxp-horizontalscrollbar.png
                        • windowsxp-label.png
                        • windowsxp-lcdnumber.png
                        • windowsxp-lineedit.png
                        • windowsxp-listview.png
                        • windowsxp-menu.png
                        • windowsxp-progressbar.png
                        • windowsxp-pushbutton.png
                        • windowsxp-radiobutton.png
                        • windowsxp-slider.png
                        • windowsxp-spinbox.png
                        • windowsxp-tableview.png
                        • windowsxp-tabwidget.png
                        • windowsxp-textedit.png
                        • windowsxp-timeedit.png
                        • windowsxp-toolbox.png
                        • windowsxp-toolbutton.png
                        • windowsxp-treeview.png
                        • woodbackground.png
                        • woodbutton.png
                      • layout.html
                      • mainwindow.html
                      • model-view-programming.html
                      • modelview-part2-main-cpp.html
                      • modelview.html
                      • qabstractbutton-members.html
                      • qabstractbutton.html
                      • qabstractgraphicsshapeitem-members.html
                      • qabstractgraphicsshapeitem.html
                      • qabstractitemdelegate-members.html
                      • qabstractitemdelegate-obsolete.html
                      • qabstractitemdelegate.html
                      • qabstractitemview-members.html
                      • qabstractitemview-obsolete.html
                      • qabstractitemview.html
                      • qabstractscrollarea-members.html
                      • qabstractscrollarea.html
                      • qabstractslider-members.html
                      • qabstractslider.html
                      • qabstractspinbox-members.html
                      • qabstractspinbox.html
                      • qaccessiblewidget-members.html
                      • qaccessiblewidget.html
                      • qaction-members.html
                      • qaction.html
                      • qactiongroup-members.html
                      • qactiongroup.html
                      • qapplication-members.html
                      • qapplication-obsolete.html
                      • qapplication.html
                      • qboxlayout-members.html
                      • qboxlayout.html
                      • qbuttongroup-members.html
                      • qbuttongroup.html
                      • qcalendarwidget-members.html
                      • qcalendarwidget.html
                      • qcheckbox-members.html
                      • qcheckbox.html
                      • qcolordialog-members.html
                      • qcolordialog-obsolete.html
                      • qcolordialog.html
                      • qcolormap-members.html
                      • qcolormap.html
                      • qcolumnview-members.html
                      • qcolumnview.html
                      • qcombobox-members.html
                      • qcombobox-obsolete.html
                      • qcombobox.html
                      • qcommandlinkbutton-members.html
                      • qcommandlinkbutton.html
                      • qcommonstyle-members.html
                      • qcommonstyle.html
                      • qcompleter-members.html
                      • qcompleter.html
                      • qdatawidgetmapper-members.html
                      • qdatawidgetmapper.html
                      • qdateedit-members.html
                      • qdateedit.html
                      • qdatetimeedit-members.html
                      • qdatetimeedit.html
                      • qdesktopwidget-members.html
                      • qdesktopwidget-obsolete.html
                      • qdesktopwidget.html
                      • qdial-members.html
                      • qdial.html
                      • qdialog-members.html
                      • qdialog-obsolete.html
                      • qdialog.html
                      • qdialogbuttonbox-members.html
                      • qdialogbuttonbox.html
                      • qdirmodel-members.html
                      • qdirmodel.html
                      • qdockwidget-members.html
                      • qdockwidget.html
                      • qdoublespinbox-members.html
                      • qdoublespinbox.html
                      • qdrawutil-h.html
                      • qerrormessage-members.html
                      • qerrormessage.html
                      • qfiledialog-members.html
                      • qfiledialog-obsolete.html
                      • qfiledialog.html
                      • qfileiconprovider-members.html
                      • qfileiconprovider.html
                      • qfilesystemmodel-members.html
                      • qfilesystemmodel.html
                      • qfocusframe-members.html
                      • qfocusframe.html
                      • qfontcombobox-members.html
                      • qfontcombobox.html
                      • qfontdialog-members.html
                      • qfontdialog.html
                      • qformlayout-members.html
                      • qformlayout.html
                      • qframe-members.html
                      • qframe.html
                      • qgesture-members.html
                      • qgesture.html
                      • qgestureevent-members.html
                      • qgestureevent.html
                      • qgesturerecognizer-members.html
                      • qgesturerecognizer.html
                      • qgraphicsanchor-members.html
                      • qgraphicsanchor.html
                      • qgraphicsanchorlayout-members.html
                      • qgraphicsanchorlayout.html
                      • qgraphicsblureffect-members.html
                      • qgraphicsblureffect.html
                      • qgraphicscolorizeeffect-members.html
                      • qgraphicscolorizeeffect.html
                      • qgraphicsdropshadoweffect-members.html
                      • qgraphicsdropshadoweffect.html
                      • qgraphicseffect-members.html
                      • qgraphicseffect.html
                      • qgraphicsellipseitem-members.html
                      • qgraphicsellipseitem.html
                      • qgraphicsgridlayout-members.html
                      • qgraphicsgridlayout.html
                      • qgraphicsitem-members.html
                      • qgraphicsitem-obsolete.html
                      • qgraphicsitem.html
                      • qgraphicsitemanimation-members.html
                      • qgraphicsitemanimation-obsolete.html
                      • qgraphicsitemanimation.html
                      • qgraphicsitemgroup-members.html
                      • qgraphicsitemgroup.html
                      • qgraphicslayout-members.html
                      • qgraphicslayout.html
                      • qgraphicslayoutitem-members.html
                      • qgraphicslayoutitem.html
                      • qgraphicslinearlayout-members.html
                      • qgraphicslinearlayout.html
                      • qgraphicslineitem-members.html
                      • qgraphicslineitem.html
                      • qgraphicsobject-members.html
                      • qgraphicsobject.html
                      • qgraphicsopacityeffect-members.html
                      • qgraphicsopacityeffect.html
                      • qgraphicspathitem-members.html
                      • qgraphicspathitem.html
                      • qgraphicspixmapitem-members.html
                      • qgraphicspixmapitem.html
                      • qgraphicspolygonitem-members.html
                      • qgraphicspolygonitem.html
                      • qgraphicsproxywidget-members.html
                      • qgraphicsproxywidget.html
                      • qgraphicsrectitem-members.html
                      • qgraphicsrectitem.html
                      • qgraphicsrotation-members.html
                      • qgraphicsrotation.html
                      • qgraphicsscale-members.html
                      • qgraphicsscale.html
                      • qgraphicsscene-members.html
                      • qgraphicsscene-obsolete.html
                      • qgraphicsscene.html
                      • qgraphicsscenecontextmenuevent-members.html
                      • qgraphicsscenecontextmenuevent.html
                      • qgraphicsscenedragdropevent-members.html
                      • qgraphicsscenedragdropevent.html
                      • qgraphicssceneevent-members.html
                      • qgraphicssceneevent.html
                      • qgraphicsscenehelpevent-members.html
                      • qgraphicsscenehelpevent.html
                      • qgraphicsscenehoverevent-members.html
                      • qgraphicsscenehoverevent.html
                      • qgraphicsscenemouseevent-members.html
                      • qgraphicsscenemouseevent.html
                      • qgraphicsscenemoveevent-members.html
                      • qgraphicsscenemoveevent.html
                      • qgraphicssceneresizeevent-members.html
                      • qgraphicssceneresizeevent.html
                      • qgraphicsscenewheelevent-members.html
                      • qgraphicsscenewheelevent.html
                      • qgraphicssimpletextitem-members.html
                      • qgraphicssimpletextitem.html
                      • qgraphicstextitem-members.html
                      • qgraphicstextitem.html
                      • qgraphicstransform-members.html
                      • qgraphicstransform.html
                      • qgraphicsview-members.html
                      • qgraphicsview-obsolete.html
                      • qgraphicsview.html
                      • qgraphicswidget-members.html
                      • qgraphicswidget.html
                      • qgridlayout-members.html
                      • qgridlayout.html
                      • qgroupbox-members.html
                      • qgroupbox.html
                      • qhboxlayout-members.html
                      • qhboxlayout.html
                      • qheaderview-members.html
                      • qheaderview-obsolete.html
                      • qheaderview.html
                      • qinputdialog-members.html
                      • qinputdialog-obsolete.html
                      • qinputdialog.html
                      • qitemdelegate-members.html
                      • qitemdelegate.html
                      • qitemeditorcreator-members.html
                      • qitemeditorcreator.html
                      • qitemeditorcreatorbase-members.html
                      • qitemeditorcreatorbase.html
                      • qitemeditorfactory-members.html
                      • qitemeditorfactory.html
                      • qkeyeventtransition-members.html
                      • qkeyeventtransition.html
                      • qkeysequenceedit-members.html
                      • qkeysequenceedit.html
                      • qlabel-members.html
                      • qlabel.html
                      • qlayout-members.html
                      • qlayout-obsolete.html
                      • qlayout.html
                      • qlayoutitem-members.html
                      • qlayoutitem.html
                      • qlcdnumber-members.html
                      • qlcdnumber.html
                      • qlineedit-members.html
                      • qlineedit.html
                      • qlistview-members.html
                      • qlistview.html
                      • qlistwidget-members.html
                      • qlistwidget-obsolete.html
                      • qlistwidget.html
                      • qlistwidgetitem-members.html
                      • qlistwidgetitem-obsolete.html
                      • qlistwidgetitem.html
                      • qmaccocoaviewcontainer-members.html
                      • qmaccocoaviewcontainer.html
                      • qmacnativewidget-members.html
                      • qmacnativewidget.html
                      • qmainwindow-members.html
                      • qmainwindow.html
                      • qmdiarea-members.html
                      • qmdiarea.html
                      • qmdisubwindow-members.html
                      • qmdisubwindow.html
                      • qmenu-members.html
                      • qmenu-obsolete.html
                      • qmenu.html
                      • qmenubar-members.html
                      • qmenubar.html
                      • qmessagebox-members.html
                      • qmessagebox-obsolete.html
                      • qmessagebox.html
                      • qmouseeventtransition-members.html
                      • qmouseeventtransition.html
                      • qopenglwidget-members.html
                      • qopenglwidget.html
                      • qpangesture-members.html
                      • qpangesture.html
                      • qpinchgesture-members.html
                      • qpinchgesture.html
                      • qplaintextdocumentlayout-members.html
                      • qplaintextdocumentlayout.html
                      • qplaintextedit-members.html
                      • qplaintextedit.html
                      • qprogressbar-members.html
                      • qprogressbar.html
                      • qprogressdialog-members.html
                      • qprogressdialog.html
                      • qproxystyle-members.html
                      • qproxystyle.html
                      • qpushbutton-members.html
                      • qpushbutton.html
                      • qradiobutton-members.html
                      • qradiobutton.html
                      • qrubberband-members.html
                      • qrubberband.html
                      • qscrollarea-members.html
                      • qscrollarea.html
                      • qscrollbar-members.html
                      • qscrollbar.html
                      • qscroller-members.html
                      • qscroller.html
                      • qscrollerproperties-members.html
                      • qscrollerproperties.html
                      • qshortcut-members.html
                      • qshortcut.html
                      • qsizegrip-members.html
                      • qsizegrip.html
                      • qsizepolicy-members.html
                      • qsizepolicy.html
                      • qslider-members.html
                      • qslider.html
                      • qspaceritem-members.html
                      • qspaceritem.html
                      • qspinbox-members.html
                      • qspinbox.html
                      • qsplashscreen-members.html
                      • qsplashscreen.html
                      • qsplitter-members.html
                      • qsplitter-obsolete.html
                      • qsplitter.html
                      • qsplitterhandle-members.html
                      • qsplitterhandle.html
                      • qstackedlayout-members.html
                      • qstackedlayout.html
                      • qstackedwidget-members.html
                      • qstackedwidget.html
                      • qstandarditemeditorcreator-members.html
                      • qstandarditemeditorcreator.html
                      • qstatusbar-members.html
                      • qstatusbar.html
                      • qstyle-members.html
                      • qstyle-obsolete.html
                      • qstyle.html
                      • qstyleditemdelegate-members.html
                      • qstyleditemdelegate.html
                      • qstylefactory-members.html
                      • qstylefactory.html
                      • qstylehintreturn-members.html
                      • qstylehintreturn.html
                      • qstylehintreturnmask-members.html
                      • qstylehintreturnmask.html
                      • qstylehintreturnvariant-members.html
                      • qstylehintreturnvariant.html
                      • qstyleoption-members.html
                      • qstyleoption-obsolete.html
                      • qstyleoption.html
                      • qstyleoptionbutton-members.html
                      • qstyleoptionbutton.html
                      • qstyleoptioncombobox-members.html
                      • qstyleoptioncombobox.html
                      • qstyleoptioncomplex-members.html
                      • qstyleoptioncomplex.html
                      • qstyleoptiondockwidget-members.html
                      • qstyleoptiondockwidget-obsolete.html
                      • qstyleoptiondockwidget.html
                      • qstyleoptionfocusrect-members.html
                      • qstyleoptionfocusrect.html
                      • qstyleoptionframe-members.html
                      • qstyleoptionframe-obsolete.html
                      • qstyleoptionframe.html
                      • qstyleoptiongraphicsitem-members.html
                      • qstyleoptiongraphicsitem-obsolete.html
                      • qstyleoptiongraphicsitem.html
                      • qstyleoptiongroupbox-members.html
                      • qstyleoptiongroupbox.html
                      • qstyleoptionheader-members.html
                      • qstyleoptionheader.html
                      • qstyleoptionmenuitem-members.html
                      • qstyleoptionmenuitem.html
                      • qstyleoptionprogressbar-members.html
                      • qstyleoptionprogressbar-obsolete.html
                      • qstyleoptionprogressbar.html
                      • qstyleoptionrubberband-members.html
                      • qstyleoptionrubberband.html
                      • qstyleoptionsizegrip-members.html
                      • qstyleoptionsizegrip.html
                      • qstyleoptionslider-members.html
                      • qstyleoptionslider.html
                      • qstyleoptionspinbox-members.html
                      • qstyleoptionspinbox.html
                      • qstyleoptiontab-members.html
                      • qstyleoptiontab-obsolete.html
                      • qstyleoptiontab.html
                      • qstyleoptiontabbarbase-members.html
                      • qstyleoptiontabbarbase-obsolete.html
                      • qstyleoptiontabbarbase.html
                      • qstyleoptiontabwidgetframe-members.html
                      • qstyleoptiontabwidgetframe-obsolete.html
                      • qstyleoptiontabwidgetframe.html
                      • qstyleoptiontitlebar-members.html
                      • qstyleoptiontitlebar.html
                      • qstyleoptiontoolbar-members.html
                      • qstyleoptiontoolbar.html
                      • qstyleoptiontoolbox-members.html
                      • qstyleoptiontoolbox-obsolete.html
                      • qstyleoptiontoolbox.html
                      • qstyleoptiontoolbutton-members.html
                      • qstyleoptiontoolbutton.html
                      • qstyleoptionviewitem-members.html
                      • qstyleoptionviewitem-obsolete.html
                      • qstyleoptionviewitem.html
                      • qstylepainter-members.html
                      • qstylepainter.html
                      • qstyleplugin-members.html
                      • qstyleplugin.html
                      • qswipegesture-members.html
                      • qswipegesture.html
                      • qsystemtrayicon-members.html
                      • qsystemtrayicon.html
                      • qtabbar-members.html
                      • qtabbar.html
                      • qtableview-members.html
                      • qtableview-obsolete.html
                      • qtableview.html
                      • qtablewidget-members.html
                      • qtablewidget-obsolete.html
                      • qtablewidget.html
                      • qtablewidgetitem-members.html
                      • qtablewidgetitem-obsolete.html
                      • qtablewidgetitem.html
                      • qtablewidgetselectionrange-members.html
                      • qtablewidgetselectionrange.html
                      • qtabwidget-members.html
                      • qtabwidget.html
                      • qtapandholdgesture-members.html
                      • qtapandholdgesture.html
                      • qtapgesture-members.html
                      • qtapgesture.html
                      • qtextbrowser-members.html
                      • qtextbrowser.html
                      • qtextedit-extraselection-members.html
                      • qtextedit-extraselection.html
                      • qtextedit-members.html
                      • qtextedit.html
                      • qtilerules-members.html
                      • qtilerules.html
                      • qtimeedit-members.html
                      • qtimeedit.html
                      • qtoolbar-members.html
                      • qtoolbar.html
                      • qtoolbox-members.html
                      • qtoolbox.html
                      • qtoolbutton-members.html
                      • qtoolbutton.html
                      • qtooltip-members.html
                      • qtooltip.html
                      • qtreeview-members.html
                      • qtreeview-obsolete.html
                      • qtreeview.html
                      • qtreewidget-members.html
                      • qtreewidget-obsolete.html
                      • qtreewidget.html
                      • qtreewidgetitem-members.html
                      • qtreewidgetitem-obsolete.html
                      • qtreewidgetitem.html
                      • qtreewidgetitemiterator-members.html
                      • qtreewidgetitemiterator.html
                      • qtwidgets-animation-animatedtiles-animatedtiles-pro.html
                      • qtwidgets-animation-animatedtiles-animatedtiles-qrc.html
                      • qtwidgets-animation-animatedtiles-example.html
                      • qtwidgets-animation-animatedtiles-main-cpp.html
                      • qtwidgets-animation-appchooser-appchooser-pro.html
                      • qtwidgets-animation-appchooser-appchooser-qrc.html
                      • qtwidgets-animation-appchooser-example.html
                      • qtwidgets-animation-appchooser-main-cpp.html
                      • qtwidgets-animation-easing-animation-h.html
                      • qtwidgets-animation-easing-easing-pro.html
                      • qtwidgets-animation-easing-easing-qrc.html
                      • qtwidgets-animation-easing-example.html
                      • qtwidgets-animation-easing-form-ui.html
                      • qtwidgets-animation-easing-main-cpp.html
                      • qtwidgets-animation-easing-window-cpp.html
                      • qtwidgets-animation-easing-window-h.html
                      • qtwidgets-animation-moveblocks-example.html
                      • qtwidgets-animation-moveblocks-main-cpp.html
                      • qtwidgets-animation-moveblocks-moveblocks-pro.html
                      • qtwidgets-animation-states-example.html
                      • qtwidgets-animation-states-main-cpp.html
                      • qtwidgets-animation-states-states-pro.html
                      • qtwidgets-animation-states-states-qrc.html
                      • qtwidgets-animation-stickman-animation-cpp.html
                      • qtwidgets-animation-stickman-animation-h.html
                      • qtwidgets-animation-stickman-example.html
                      • qtwidgets-animation-stickman-graphicsview-cpp.html
                      • qtwidgets-animation-stickman-graphicsview-h.html
                      • qtwidgets-animation-stickman-lifecycle-cpp.html
                      • qtwidgets-animation-stickman-lifecycle-h.html
                      • qtwidgets-animation-stickman-main-cpp.html
                      • qtwidgets-animation-stickman-node-cpp.html
                      • qtwidgets-animation-stickman-node-h.html
                      • qtwidgets-animation-stickman-rectbutton-cpp.html
                      • qtwidgets-animation-stickman-rectbutton-h.html
                      • qtwidgets-animation-stickman-stickman-cpp.html
                      • qtwidgets-animation-stickman-stickman-h.html
                      • qtwidgets-animation-stickman-stickman-pro.html
                      • qtwidgets-animation-stickman-stickman-qrc.html
                      • qtwidgets-animation-sub-attaq-animationmanager-cpp.html
                      • qtwidgets-animation-sub-attaq-animationmanager-h.html
                      • qtwidgets-animation-sub-attaq-boat-cpp.html
                      • qtwidgets-animation-sub-attaq-boat-h.html
                      • qtwidgets-animation-sub-attaq-boat-p-h.html
                      • qtwidgets-animation-sub-attaq-bomb-cpp.html
                      • qtwidgets-animation-sub-attaq-bomb-h.html
                      • qtwidgets-animation-sub-attaq-data-xml.html
                      • qtwidgets-animation-sub-attaq-example.html
                      • qtwidgets-animation-sub-attaq-graphicsscene-cpp.html
                      • qtwidgets-animation-sub-attaq-graphicsscene-h.html
                      • qtwidgets-animation-sub-attaq-main-cpp.html
                      • qtwidgets-animation-sub-attaq-mainwindow-cpp.html
                      • qtwidgets-animation-sub-attaq-mainwindow-h.html
                      • qtwidgets-animation-sub-attaq-pics-scalable-background-n810-svg.html
                      • qtwidgets-animation-sub-attaq-pics-scalable-background-svg.html
                      • qtwidgets-animation-sub-attaq-pics-scalable-boat-svg.html
                      • qtwidgets-animation-sub-attaq-pics-scalable-bomb-svg.html
                      • qtwidgets-animation-sub-attaq-pics-scalable-sand-svg.html
                      • qtwidgets-animation-sub-attaq-pics-scalable-see-svg.html
                      • qtwidgets-animation-sub-attaq-pics-scalable-sky-svg.html
                      • qtwidgets-animation-sub-attaq-pics-scalable-sub-attaq-svg.html
                      • qtwidgets-animation-sub-attaq-pics-scalable-submarine-svg.html
                      • qtwidgets-animation-sub-attaq-pics-scalable-surface-svg.html
                      • qtwidgets-animation-sub-attaq-pics-scalable-torpedo-svg.html
                      • qtwidgets-animation-sub-attaq-pixmapitem-cpp.html
                      • qtwidgets-animation-sub-attaq-pixmapitem-h.html
                      • qtwidgets-animation-sub-attaq-progressitem-cpp.html
                      • qtwidgets-animation-sub-attaq-progressitem-h.html
                      • qtwidgets-animation-sub-attaq-qanimationstate-cpp.html
                      • qtwidgets-animation-sub-attaq-qanimationstate-h.html
                      • qtwidgets-animation-sub-attaq-states-cpp.html
                      • qtwidgets-animation-sub-attaq-states-h.html
                      • qtwidgets-animation-sub-attaq-sub-attaq-pro.html
                      • qtwidgets-animation-sub-attaq-subattaq-qrc.html
                      • qtwidgets-animation-sub-attaq-submarine-cpp.html
                      • qtwidgets-animation-sub-attaq-submarine-h.html
                      • qtwidgets-animation-sub-attaq-submarine-p-h.html
                      • qtwidgets-animation-sub-attaq-textinformationitem-cpp.html
                      • qtwidgets-animation-sub-attaq-textinformationitem-h.html
                      • qtwidgets-animation-sub-attaq-torpedo-cpp.html
                      • qtwidgets-animation-sub-attaq-torpedo-h.html
                      • qtwidgets-desktop-screenshot-example.html
                      • qtwidgets-desktop-screenshot-main-cpp.html
                      • qtwidgets-desktop-screenshot-screenshot-cpp.html
                      • qtwidgets-desktop-screenshot-screenshot-h.html
                      • qtwidgets-desktop-screenshot-screenshot-pro.html
                      • qtwidgets-desktop-systray-example.html
                      • qtwidgets-desktop-systray-main-cpp.html
                      • qtwidgets-desktop-systray-systray-pro.html
                      • qtwidgets-desktop-systray-systray-qrc.html
                      • qtwidgets-desktop-systray-window-cpp.html
                      • qtwidgets-desktop-systray-window-h.html
                      • qtwidgets-dialogs-classwizard-classwizard-cpp.html
                      • qtwidgets-dialogs-classwizard-classwizard-h.html
                      • qtwidgets-dialogs-classwizard-classwizard-pro.html
                      • qtwidgets-dialogs-classwizard-classwizard-qrc.html
                      • qtwidgets-dialogs-classwizard-example.html
                      • qtwidgets-dialogs-classwizard-main-cpp.html
                      • qtwidgets-dialogs-configdialog-configdialog-cpp.html
                      • qtwidgets-dialogs-configdialog-configdialog-h.html
                      • qtwidgets-dialogs-configdialog-configdialog-pro.html
                      • qtwidgets-dialogs-configdialog-configdialog-qrc.html
                      • qtwidgets-dialogs-configdialog-example.html
                      • qtwidgets-dialogs-configdialog-main-cpp.html
                      • qtwidgets-dialogs-configdialog-pages-cpp.html
                      • qtwidgets-dialogs-configdialog-pages-h.html
                      • qtwidgets-dialogs-extension-example.html
                      • qtwidgets-dialogs-extension-extension-pro.html
                      • qtwidgets-dialogs-extension-finddialog-cpp.html
                      • qtwidgets-dialogs-extension-finddialog-h.html
                      • qtwidgets-dialogs-extension-main-cpp.html
                      • qtwidgets-dialogs-findfiles-example.html
                      • qtwidgets-dialogs-findfiles-findfiles-pro.html
                      • qtwidgets-dialogs-findfiles-main-cpp.html
                      • qtwidgets-dialogs-findfiles-window-cpp.html
                      • qtwidgets-dialogs-findfiles-window-h.html
                      • qtwidgets-dialogs-licensewizard-example.html
                      • qtwidgets-dialogs-licensewizard-licensewizard-cpp.html
                      • qtwidgets-dialogs-licensewizard-licensewizard-h.html
                      • qtwidgets-dialogs-licensewizard-licensewizard-pro.html
                      • qtwidgets-dialogs-licensewizard-licensewizard-qrc.html
                      • qtwidgets-dialogs-licensewizard-main-cpp.html
                      • qtwidgets-dialogs-sipdialog-dialog-cpp.html
                      • qtwidgets-dialogs-sipdialog-dialog-h.html
                      • qtwidgets-dialogs-sipdialog-example.html
                      • qtwidgets-dialogs-sipdialog-main-cpp.html
                      • qtwidgets-dialogs-sipdialog-sipdialog-pro.html
                      • qtwidgets-dialogs-standarddialogs-dialog-cpp.html
                      • qtwidgets-dialogs-standarddialogs-dialog-h.html
                      • qtwidgets-dialogs-standarddialogs-example.html
                      • qtwidgets-dialogs-standarddialogs-main-cpp.html
                      • qtwidgets-dialogs-standarddialogs-standarddialogs-pro.html
                      • qtwidgets-dialogs-tabdialog-example.html
                      • qtwidgets-dialogs-tabdialog-main-cpp.html
                      • qtwidgets-dialogs-tabdialog-tabdialog-cpp.html
                      • qtwidgets-dialogs-tabdialog-tabdialog-h.html
                      • qtwidgets-dialogs-tabdialog-tabdialog-pro.html
                      • qtwidgets-dialogs-trivialwizard-example.html
                      • qtwidgets-dialogs-trivialwizard-trivialwizard-cpp.html
                      • qtwidgets-dialogs-trivialwizard-trivialwizard-pro.html
                      • qtwidgets-draganddrop-draggableicons-draggableicons-pro.html
                      • qtwidgets-draganddrop-draggableicons-draggableicons-qrc.html
                      • qtwidgets-draganddrop-draggableicons-dragwidget-cpp.html
                      • qtwidgets-draganddrop-draggableicons-dragwidget-h.html
                      • qtwidgets-draganddrop-draggableicons-example.html
                      • qtwidgets-draganddrop-draggableicons-main-cpp.html
                      • qtwidgets-draganddrop-draggabletext-draggabletext-pro.html
                      • qtwidgets-draganddrop-draggabletext-draggabletext-qrc.html
                      • qtwidgets-draganddrop-draggabletext-dragwidget-cpp.html
                      • qtwidgets-draganddrop-draggabletext-dragwidget-h.html
                      • qtwidgets-draganddrop-draggabletext-example.html
                      • qtwidgets-draganddrop-draggabletext-main-cpp.html
                      • qtwidgets-draganddrop-dropsite-droparea-cpp.html
                      • qtwidgets-draganddrop-dropsite-droparea-h.html
                      • qtwidgets-draganddrop-dropsite-dropsite-pro.html
                      • qtwidgets-draganddrop-dropsite-dropsitewindow-cpp.html
                      • qtwidgets-draganddrop-dropsite-dropsitewindow-h.html
                      • qtwidgets-draganddrop-dropsite-example.html
                      • qtwidgets-draganddrop-dropsite-main-cpp.html
                      • qtwidgets-draganddrop-fridgemagnets-draglabel-cpp.html
                      • qtwidgets-draganddrop-fridgemagnets-draglabel-h.html
                      • qtwidgets-draganddrop-fridgemagnets-dragwidget-cpp.html
                      • qtwidgets-draganddrop-fridgemagnets-dragwidget-h.html
                      • qtwidgets-draganddrop-fridgemagnets-example.html
                      • qtwidgets-draganddrop-fridgemagnets-fridgemagnets-pro.html
                      • qtwidgets-draganddrop-fridgemagnets-fridgemagnets-qrc.html
                      • qtwidgets-draganddrop-fridgemagnets-main-cpp.html
                      • qtwidgets-draganddrop-puzzle-example.html
                      • qtwidgets-draganddrop-puzzle-main-cpp.html
                      • qtwidgets-draganddrop-puzzle-mainwindow-cpp.html
                      • qtwidgets-draganddrop-puzzle-mainwindow-h.html
                      • qtwidgets-draganddrop-puzzle-pieceslist-cpp.html
                      • qtwidgets-draganddrop-puzzle-pieceslist-h.html
                      • qtwidgets-draganddrop-puzzle-puzzle-pro.html
                      • qtwidgets-draganddrop-puzzle-puzzle-qrc.html
                      • qtwidgets-draganddrop-puzzle-puzzlewidget-cpp.html
                      • qtwidgets-draganddrop-puzzle-puzzlewidget-h.html
                      • qtwidgets-effects-blurpicker-blureffect-cpp.html
                      • qtwidgets-effects-blurpicker-blureffect-h.html
                      • qtwidgets-effects-blurpicker-blurpicker-cpp.html
                      • qtwidgets-effects-blurpicker-blurpicker-h.html
                      • qtwidgets-effects-blurpicker-blurpicker-pro.html
                      • qtwidgets-effects-blurpicker-blurpicker-qrc.html
                      • qtwidgets-effects-blurpicker-example.html
                      • qtwidgets-effects-blurpicker-main-cpp.html
                      • qtwidgets-effects-fademessage-example.html
                      • qtwidgets-effects-fademessage-fademessage-cpp.html
                      • qtwidgets-effects-fademessage-fademessage-h.html
                      • qtwidgets-effects-fademessage-fademessage-pro.html
                      • qtwidgets-effects-fademessage-fademessage-qrc.html
                      • qtwidgets-effects-fademessage-main-cpp.html
                      • qtwidgets-effects-lighting-example.html
                      • qtwidgets-effects-lighting-lighting-cpp.html
                      • qtwidgets-effects-lighting-lighting-h.html
                      • qtwidgets-effects-lighting-lighting-pro.html
                      • qtwidgets-effects-lighting-main-cpp.html
                      • qtwidgets-gestures-imagegestures-example.html
                      • qtwidgets-gestures-imagegestures-imagegestures-pro.html
                      • qtwidgets-gestures-imagegestures-imagewidget-cpp.html
                      • qtwidgets-gestures-imagegestures-imagewidget-h.html
                      • qtwidgets-gestures-imagegestures-main-cpp.html
                      • qtwidgets-gestures-imagegestures-mainwidget-cpp.html
                      • qtwidgets-gestures-imagegestures-mainwidget-h.html
                      • qtwidgets-graphicsview-anchorlayout-anchorlayout-pro.html
                      • qtwidgets-graphicsview-anchorlayout-example.html
                      • qtwidgets-graphicsview-anchorlayout-main-cpp.html
                      • qtwidgets-graphicsview-basicgraphicslayouts-basicgraphicslayouts-pro.html
                      • qtwidgets-graphicsview-basicgraphicslayouts-basicgraphicslayouts-qrc.html
                      • qtwidgets-graphicsview-basicgraphicslayouts-example.html
                      • qtwidgets-graphicsview-basicgraphicslayouts-layoutitem-cpp.html
                      • qtwidgets-graphicsview-basicgraphicslayouts-layoutitem-h.html
                      • qtwidgets-graphicsview-basicgraphicslayouts-main-cpp.html
                      • qtwidgets-graphicsview-basicgraphicslayouts-window-cpp.html
                      • qtwidgets-graphicsview-basicgraphicslayouts-window-h.html
                      • qtwidgets-graphicsview-boxes-3rdparty-fbm-h.html
                      • qtwidgets-graphicsview-boxes-boxes-pro.html
                      • qtwidgets-graphicsview-boxes-boxes-qrc.html
                      • qtwidgets-graphicsview-boxes-example.html
                      • qtwidgets-graphicsview-boxes-glbuffers-cpp.html
                      • qtwidgets-graphicsview-boxes-glbuffers-h.html
                      • qtwidgets-graphicsview-boxes-glextensions-cpp.html
                      • qtwidgets-graphicsview-boxes-glextensions-h.html
                      • qtwidgets-graphicsview-boxes-gltrianglemesh-h.html
                      • qtwidgets-graphicsview-boxes-main-cpp.html
                      • qtwidgets-graphicsview-boxes-qtbox-cpp.html
                      • qtwidgets-graphicsview-boxes-qtbox-h.html
                      • qtwidgets-graphicsview-boxes-roundedbox-cpp.html
                      • qtwidgets-graphicsview-boxes-roundedbox-h.html
                      • qtwidgets-graphicsview-boxes-scene-cpp.html
                      • qtwidgets-graphicsview-boxes-scene-h.html
                      • qtwidgets-graphicsview-boxes-trackball-cpp.html
                      • qtwidgets-graphicsview-boxes-trackball-h.html
                      • qtwidgets-graphicsview-chip-chip-cpp.html
                      • qtwidgets-graphicsview-chip-chip-h.html
                      • qtwidgets-graphicsview-chip-chip-pro.html
                      • qtwidgets-graphicsview-chip-example.html
                      • qtwidgets-graphicsview-chip-images-qrc.html
                      • qtwidgets-graphicsview-chip-main-cpp.html
                      • qtwidgets-graphicsview-chip-mainwindow-cpp.html
                      • qtwidgets-graphicsview-chip-mainwindow-h.html
                      • qtwidgets-graphicsview-chip-view-cpp.html
                      • qtwidgets-graphicsview-chip-view-h.html
                      • qtwidgets-graphicsview-collidingmice-collidingmice-pro.html
                      • qtwidgets-graphicsview-collidingmice-example.html
                      • qtwidgets-graphicsview-collidingmice-main-cpp.html
                      • qtwidgets-graphicsview-collidingmice-mice-qrc.html
                      • qtwidgets-graphicsview-collidingmice-mouse-cpp.html
                      • qtwidgets-graphicsview-collidingmice-mouse-h.html
                      • qtwidgets-graphicsview-diagramscene-arrow-cpp.html
                      • qtwidgets-graphicsview-diagramscene-arrow-h.html
                      • qtwidgets-graphicsview-diagramscene-diagramitem-cpp.html
                      • qtwidgets-graphicsview-diagramscene-diagramitem-h.html
                      • qtwidgets-graphicsview-diagramscene-diagramscene-cpp.html
                      • qtwidgets-graphicsview-diagramscene-diagramscene-h.html
                      • qtwidgets-graphicsview-diagramscene-diagramscene-pro.html
                      • qtwidgets-graphicsview-diagramscene-diagramscene-qrc.html
                      • qtwidgets-graphicsview-diagramscene-diagramtextitem-cpp.html
                      • qtwidgets-graphicsview-diagramscene-diagramtextitem-h.html
                      • qtwidgets-graphicsview-diagramscene-example.html
                      • qtwidgets-graphicsview-diagramscene-main-cpp.html
                      • qtwidgets-graphicsview-diagramscene-mainwindow-cpp.html
                      • qtwidgets-graphicsview-diagramscene-mainwindow-h.html
                      • qtwidgets-graphicsview-dragdroprobot-coloritem-cpp.html
                      • qtwidgets-graphicsview-dragdroprobot-coloritem-h.html
                      • qtwidgets-graphicsview-dragdroprobot-dragdroprobot-pro.html
                      • qtwidgets-graphicsview-dragdroprobot-example.html
                      • qtwidgets-graphicsview-dragdroprobot-main-cpp.html
                      • qtwidgets-graphicsview-dragdroprobot-robot-cpp.html
                      • qtwidgets-graphicsview-dragdroprobot-robot-h.html
                      • qtwidgets-graphicsview-dragdroprobot-robot-qrc.html
                      • qtwidgets-graphicsview-elasticnodes-edge-cpp.html
                      • qtwidgets-graphicsview-elasticnodes-edge-h.html
                      • qtwidgets-graphicsview-elasticnodes-elasticnodes-pro.html
                      • qtwidgets-graphicsview-elasticnodes-example.html
                      • qtwidgets-graphicsview-elasticnodes-graphwidget-cpp.html
                      • qtwidgets-graphicsview-elasticnodes-graphwidget-h.html
                      • qtwidgets-graphicsview-elasticnodes-main-cpp.html
                      • qtwidgets-graphicsview-elasticnodes-node-cpp.html
                      • qtwidgets-graphicsview-elasticnodes-node-h.html
                      • qtwidgets-graphicsview-embeddeddialogs-customproxy-cpp.html
                      • qtwidgets-graphicsview-embeddeddialogs-customproxy-h.html
                      • qtwidgets-graphicsview-embeddeddialogs-embeddeddialog-cpp.html
                      • qtwidgets-graphicsview-embeddeddialogs-embeddeddialog-h.html
                      • qtwidgets-graphicsview-embeddeddialogs-embeddeddialog-ui.html
                      • qtwidgets-graphicsview-embeddeddialogs-embeddeddialogs-pro.html
                      • qtwidgets-graphicsview-embeddeddialogs-embeddeddialogs-qrc.html
                      • qtwidgets-graphicsview-embeddeddialogs-example.html
                      • qtwidgets-graphicsview-embeddeddialogs-main-cpp.html
                      • qtwidgets-graphicsview-flowlayout-example.html
                      • qtwidgets-graphicsview-flowlayout-flowlayout-cpp.html
                      • qtwidgets-graphicsview-flowlayout-flowlayout-h.html
                      • qtwidgets-graphicsview-flowlayout-flowlayout-pro.html
                      • qtwidgets-graphicsview-flowlayout-main-cpp.html
                      • qtwidgets-graphicsview-flowlayout-window-cpp.html
                      • qtwidgets-graphicsview-flowlayout-window-h.html
                      • qtwidgets-graphicsview-padnavigator-example.html
                      • qtwidgets-graphicsview-padnavigator-flippablepad-cpp.html
                      • qtwidgets-graphicsview-padnavigator-flippablepad-h.html
                      • qtwidgets-graphicsview-padnavigator-form-ui.html
                      • qtwidgets-graphicsview-padnavigator-main-cpp.html
                      • qtwidgets-graphicsview-padnavigator-padnavigator-cpp.html
                      • qtwidgets-graphicsview-padnavigator-padnavigator-h.html
                      • qtwidgets-graphicsview-padnavigator-padnavigator-pro.html
                      • qtwidgets-graphicsview-padnavigator-padnavigator-qrc.html
                      • qtwidgets-graphicsview-padnavigator-roundrectitem-cpp.html
                      • qtwidgets-graphicsview-padnavigator-roundrectitem-h.html
                      • qtwidgets-graphicsview-padnavigator-splashitem-cpp.html
                      • qtwidgets-graphicsview-padnavigator-splashitem-h.html
                      • qtwidgets-graphicsview-simpleanchorlayout-example.html
                      • qtwidgets-graphicsview-simpleanchorlayout-main-cpp.html
                      • qtwidgets-graphicsview-simpleanchorlayout-simpleanchorlayout-pro.html
                      • qtwidgets-graphicsview-weatheranchorlayout-example.html
                      • qtwidgets-graphicsview-weatheranchorlayout-main-cpp.html
                      • qtwidgets-graphicsview-weatheranchorlayout-weatheranchorlayout-pro.html
                      • qtwidgets-graphicsview-weatheranchorlayout-weatheranchorlayout-qrc.html
                      • qtwidgets-index.html
                      • qtwidgets-itemviews-addressbook-adddialog-cpp.html
                      • qtwidgets-itemviews-addressbook-adddialog-h.html
                      • qtwidgets-itemviews-addressbook-addressbook-pro.html
                      • qtwidgets-itemviews-addressbook-addresswidget-cpp.html
                      • qtwidgets-itemviews-addressbook-addresswidget-h.html
                      • qtwidgets-itemviews-addressbook-example.html
                      • qtwidgets-itemviews-addressbook-main-cpp.html
                      • qtwidgets-itemviews-addressbook-mainwindow-cpp.html
                      • qtwidgets-itemviews-addressbook-mainwindow-h.html
                      • qtwidgets-itemviews-addressbook-newaddresstab-cpp.html
                      • qtwidgets-itemviews-addressbook-newaddresstab-h.html
                      • qtwidgets-itemviews-addressbook-tablemodel-cpp.html
                      • qtwidgets-itemviews-addressbook-tablemodel-h.html
                      • qtwidgets-itemviews-basicsortfiltermodel-basicsortfiltermodel-pro.html
                      • qtwidgets-itemviews-basicsortfiltermodel-example.html
                      • qtwidgets-itemviews-basicsortfiltermodel-main-cpp.html
                      • qtwidgets-itemviews-basicsortfiltermodel-window-cpp.html
                      • qtwidgets-itemviews-basicsortfiltermodel-window-h.html
                      • qtwidgets-itemviews-chart-chart-pro.html
                      • qtwidgets-itemviews-chart-chart-qrc.html
                      • qtwidgets-itemviews-chart-example.html
                      • qtwidgets-itemviews-chart-main-cpp.html
                      • qtwidgets-itemviews-chart-mainwindow-cpp.html
                      • qtwidgets-itemviews-chart-mainwindow-h.html
                      • qtwidgets-itemviews-chart-pieview-cpp.html
                      • qtwidgets-itemviews-chart-pieview-h.html
                      • qtwidgets-itemviews-coloreditorfactory-coloreditorfactory-pro.html
                      • qtwidgets-itemviews-coloreditorfactory-colorlisteditor-cpp.html
                      • qtwidgets-itemviews-coloreditorfactory-colorlisteditor-h.html
                      • qtwidgets-itemviews-coloreditorfactory-example.html
                      • qtwidgets-itemviews-coloreditorfactory-main-cpp.html
                      • qtwidgets-itemviews-coloreditorfactory-window-cpp.html
                      • qtwidgets-itemviews-coloreditorfactory-window-h.html
                      • qtwidgets-itemviews-combowidgetmapper-combowidgetmapper-pro.html
                      • qtwidgets-itemviews-combowidgetmapper-example.html
                      • qtwidgets-itemviews-combowidgetmapper-main-cpp.html
                      • qtwidgets-itemviews-combowidgetmapper-window-cpp.html
                      • qtwidgets-itemviews-combowidgetmapper-window-h.html
                      • qtwidgets-itemviews-customsortfiltermodel-customsortfiltermodel-pro.html
                      • qtwidgets-itemviews-customsortfiltermodel-customsortfiltermodel-qrc.html
                      • qtwidgets-itemviews-customsortfiltermodel-example.html
                      • qtwidgets-itemviews-customsortfiltermodel-filterwidget-cpp.html
                      • qtwidgets-itemviews-customsortfiltermodel-filterwidget-h.html
                      • qtwidgets-itemviews-customsortfiltermodel-main-cpp.html
                      • qtwidgets-itemviews-customsortfiltermodel-mysortfilterproxymodel-cpp.html
                      • qtwidgets-itemviews-customsortfiltermodel-mysortfilterproxymodel-h.html
                      • qtwidgets-itemviews-customsortfiltermodel-window-cpp.html
                      • qtwidgets-itemviews-customsortfiltermodel-window-h.html
                      • qtwidgets-itemviews-dirview-dirview-pro.html
                      • qtwidgets-itemviews-dirview-example.html
                      • qtwidgets-itemviews-dirview-main-cpp.html
                      • qtwidgets-itemviews-editabletreemodel-editabletreemodel-pro.html
                      • qtwidgets-itemviews-editabletreemodel-editabletreemodel-qrc.html
                      • qtwidgets-itemviews-editabletreemodel-example.html
                      • qtwidgets-itemviews-editabletreemodel-main-cpp.html
                      • qtwidgets-itemviews-editabletreemodel-mainwindow-cpp.html
                      • qtwidgets-itemviews-editabletreemodel-mainwindow-h.html
                      • qtwidgets-itemviews-editabletreemodel-mainwindow-ui.html
                      • qtwidgets-itemviews-editabletreemodel-treeitem-cpp.html
                      • qtwidgets-itemviews-editabletreemodel-treeitem-h.html
                      • qtwidgets-itemviews-editabletreemodel-treemodel-cpp.html
                      • qtwidgets-itemviews-editabletreemodel-treemodel-h.html
                      • qtwidgets-itemviews-fetchmore-example.html
                      • qtwidgets-itemviews-fetchmore-fetchmore-pro.html
                      • qtwidgets-itemviews-fetchmore-filelistmodel-cpp.html
                      • qtwidgets-itemviews-fetchmore-filelistmodel-h.html
                      • qtwidgets-itemviews-fetchmore-main-cpp.html
                      • qtwidgets-itemviews-fetchmore-window-cpp.html
                      • qtwidgets-itemviews-fetchmore-window-h.html
                      • qtwidgets-itemviews-frozencolumn-example.html
                      • qtwidgets-itemviews-frozencolumn-freezetablewidget-cpp.html
                      • qtwidgets-itemviews-frozencolumn-freezetablewidget-h.html
                      • qtwidgets-itemviews-frozencolumn-frozencolumn-pro.html
                      • qtwidgets-itemviews-frozencolumn-grades-qrc.html
                      • qtwidgets-itemviews-frozencolumn-main-cpp.html
                      • qtwidgets-itemviews-interview-example.html
                      • qtwidgets-itemviews-interview-interview-pro.html
                      • qtwidgets-itemviews-interview-interview-qrc.html
                      • qtwidgets-itemviews-interview-main-cpp.html
                      • qtwidgets-itemviews-interview-model-cpp.html
                      • qtwidgets-itemviews-interview-model-h.html
                      • qtwidgets-itemviews-pixelator-example.html
                      • qtwidgets-itemviews-pixelator-imagemodel-cpp.html
                      • qtwidgets-itemviews-pixelator-imagemodel-h.html
                      • qtwidgets-itemviews-pixelator-images-qrc.html
                      • qtwidgets-itemviews-pixelator-main-cpp.html
                      • qtwidgets-itemviews-pixelator-mainwindow-cpp.html
                      • qtwidgets-itemviews-pixelator-mainwindow-h.html
                      • qtwidgets-itemviews-pixelator-pixelator-pro.html
                      • qtwidgets-itemviews-pixelator-pixeldelegate-cpp.html
                      • qtwidgets-itemviews-pixelator-pixeldelegate-h.html
                      • qtwidgets-itemviews-puzzle-example.html
                      • qtwidgets-itemviews-puzzle-main-cpp.html
                      • qtwidgets-itemviews-puzzle-mainwindow-cpp.html
                      • qtwidgets-itemviews-puzzle-mainwindow-h.html
                      • qtwidgets-itemviews-puzzle-piecesmodel-cpp.html
                      • qtwidgets-itemviews-puzzle-piecesmodel-h.html
                      • qtwidgets-itemviews-puzzle-puzzle-pro.html
                      • qtwidgets-itemviews-puzzle-puzzle-qrc.html
                      • qtwidgets-itemviews-puzzle-puzzlewidget-cpp.html
                      • qtwidgets-itemviews-puzzle-puzzlewidget-h.html
                      • qtwidgets-itemviews-simpledommodel-domitem-cpp.html
                      • qtwidgets-itemviews-simpledommodel-domitem-h.html
                      • qtwidgets-itemviews-simpledommodel-dommodel-cpp.html
                      • qtwidgets-itemviews-simpledommodel-dommodel-h.html
                      • qtwidgets-itemviews-simpledommodel-example.html
                      • qtwidgets-itemviews-simpledommodel-main-cpp.html
                      • qtwidgets-itemviews-simpledommodel-mainwindow-cpp.html
                      • qtwidgets-itemviews-simpledommodel-mainwindow-h.html
                      • qtwidgets-itemviews-simpledommodel-simpledommodel-pro.html
                      • qtwidgets-itemviews-simpletreemodel-example.html
                      • qtwidgets-itemviews-simpletreemodel-main-cpp.html
                      • qtwidgets-itemviews-simpletreemodel-simpletreemodel-pro.html
                      • qtwidgets-itemviews-simpletreemodel-simpletreemodel-qrc.html
                      • qtwidgets-itemviews-simpletreemodel-treeitem-cpp.html
                      • qtwidgets-itemviews-simpletreemodel-treeitem-h.html
                      • qtwidgets-itemviews-simpletreemodel-treemodel-cpp.html
                      • qtwidgets-itemviews-simpletreemodel-treemodel-h.html
                      • qtwidgets-itemviews-simplewidgetmapper-example.html
                      • qtwidgets-itemviews-simplewidgetmapper-main-cpp.html
                      • qtwidgets-itemviews-simplewidgetmapper-simplewidgetmapper-pro.html
                      • qtwidgets-itemviews-simplewidgetmapper-window-cpp.html
                      • qtwidgets-itemviews-simplewidgetmapper-window-h.html
                      • qtwidgets-itemviews-spinboxdelegate-delegate-cpp.html
                      • qtwidgets-itemviews-spinboxdelegate-delegate-h.html
                      • qtwidgets-itemviews-spinboxdelegate-example.html
                      • qtwidgets-itemviews-spinboxdelegate-main-cpp.html
                      • qtwidgets-itemviews-spinboxdelegate-spinboxdelegate-pro.html
                      • qtwidgets-itemviews-spreadsheet-example.html
                      • qtwidgets-itemviews-spreadsheet-main-cpp.html
                      • qtwidgets-itemviews-spreadsheet-printview-cpp.html
                      • qtwidgets-itemviews-spreadsheet-printview-h.html
                      • qtwidgets-itemviews-spreadsheet-spreadsheet-cpp.html
                      • qtwidgets-itemviews-spreadsheet-spreadsheet-h.html
                      • qtwidgets-itemviews-spreadsheet-spreadsheet-pro.html
                      • qtwidgets-itemviews-spreadsheet-spreadsheet-qrc.html
                      • qtwidgets-itemviews-spreadsheet-spreadsheetdelegate-cpp.html
                      • qtwidgets-itemviews-spreadsheet-spreadsheetdelegate-h.html
                      • qtwidgets-itemviews-spreadsheet-spreadsheetitem-cpp.html
                      • qtwidgets-itemviews-spreadsheet-spreadsheetitem-h.html
                      • qtwidgets-itemviews-stardelegate-example.html
                      • qtwidgets-itemviews-stardelegate-main-cpp.html
                      • qtwidgets-itemviews-stardelegate-stardelegate-cpp.html
                      • qtwidgets-itemviews-stardelegate-stardelegate-h.html
                      • qtwidgets-itemviews-stardelegate-stardelegate-pro.html
                      • qtwidgets-itemviews-stardelegate-stareditor-cpp.html
                      • qtwidgets-itemviews-stardelegate-stareditor-h.html
                      • qtwidgets-itemviews-stardelegate-starrating-cpp.html
                      • qtwidgets-itemviews-stardelegate-starrating-h.html
                      • qtwidgets-layouts-basiclayouts-basiclayouts-pro.html
                      • qtwidgets-layouts-basiclayouts-dialog-cpp.html
                      • qtwidgets-layouts-basiclayouts-dialog-h.html
                      • qtwidgets-layouts-basiclayouts-example.html
                      • qtwidgets-layouts-basiclayouts-main-cpp.html
                      • qtwidgets-layouts-borderlayout-borderlayout-cpp.html
                      • qtwidgets-layouts-borderlayout-borderlayout-h.html
                      • qtwidgets-layouts-borderlayout-borderlayout-pro.html
                      • qtwidgets-layouts-borderlayout-example.html
                      • qtwidgets-layouts-borderlayout-main-cpp.html
                      • qtwidgets-layouts-borderlayout-window-cpp.html
                      • qtwidgets-layouts-borderlayout-window-h.html
                      • qtwidgets-layouts-dynamiclayouts-dialog-cpp.html
                      • qtwidgets-layouts-dynamiclayouts-dialog-h.html
                      • qtwidgets-layouts-dynamiclayouts-dynamiclayouts-pro.html
                      • qtwidgets-layouts-dynamiclayouts-example.html
                      • qtwidgets-layouts-dynamiclayouts-main-cpp.html
                      • qtwidgets-layouts-flowlayout-example.html
                      • qtwidgets-layouts-flowlayout-flowlayout-cpp.html
                      • qtwidgets-layouts-flowlayout-flowlayout-h.html
                      • qtwidgets-layouts-flowlayout-flowlayout-pro.html
                      • qtwidgets-layouts-flowlayout-main-cpp.html
                      • qtwidgets-layouts-flowlayout-window-cpp.html
                      • qtwidgets-layouts-flowlayout-window-h.html
                      • qtwidgets-mainwindows-application-application-pro.html
                      • qtwidgets-mainwindows-application-application-qrc.html
                      • qtwidgets-mainwindows-application-example.html
                      • qtwidgets-mainwindows-application-main-cpp.html
                      • qtwidgets-mainwindows-application-mainwindow-cpp.html
                      • qtwidgets-mainwindows-application-mainwindow-h.html
                      • qtwidgets-mainwindows-dockwidgets-dockwidgets-pro.html
                      • qtwidgets-mainwindows-dockwidgets-dockwidgets-qrc.html
                      • qtwidgets-mainwindows-dockwidgets-example.html
                      • qtwidgets-mainwindows-dockwidgets-main-cpp.html
                      • qtwidgets-mainwindows-dockwidgets-mainwindow-cpp.html
                      • qtwidgets-mainwindows-dockwidgets-mainwindow-h.html
                      • qtwidgets-mainwindows-mainwindow-colorswatch-cpp.html
                      • qtwidgets-mainwindows-mainwindow-colorswatch-h.html
                      • qtwidgets-mainwindows-mainwindow-example.html
                      • qtwidgets-mainwindows-mainwindow-main-cpp.html
                      • qtwidgets-mainwindows-mainwindow-mainwindow-cpp.html
                      • qtwidgets-mainwindows-mainwindow-mainwindow-h.html
                      • qtwidgets-mainwindows-mainwindow-mainwindow-pro.html
                      • qtwidgets-mainwindows-mainwindow-mainwindow-qrc.html
                      • qtwidgets-mainwindows-mainwindow-toolbar-cpp.html
                      • qtwidgets-mainwindows-mainwindow-toolbar-h.html
                      • qtwidgets-mainwindows-mdi-example.html
                      • qtwidgets-mainwindows-mdi-main-cpp.html
                      • qtwidgets-mainwindows-mdi-mainwindow-cpp.html
                      • qtwidgets-mainwindows-mdi-mainwindow-h.html
                      • qtwidgets-mainwindows-mdi-mdi-pro.html
                      • qtwidgets-mainwindows-mdi-mdi-qrc.html
                      • qtwidgets-mainwindows-mdi-mdichild-cpp.html
                      • qtwidgets-mainwindows-mdi-mdichild-h.html
                      • qtwidgets-mainwindows-menus-example.html
                      • qtwidgets-mainwindows-menus-main-cpp.html
                      • qtwidgets-mainwindows-menus-mainwindow-cpp.html
                      • qtwidgets-mainwindows-menus-mainwindow-h.html
                      • qtwidgets-mainwindows-menus-menus-pro.html
                      • qtwidgets-mainwindows-sdi-example.html
                      • qtwidgets-mainwindows-sdi-main-cpp.html
                      • qtwidgets-mainwindows-sdi-mainwindow-cpp.html
                      • qtwidgets-mainwindows-sdi-mainwindow-h.html
                      • qtwidgets-mainwindows-sdi-sdi-pro.html
                      • qtwidgets-mainwindows-sdi-sdi-qrc.html
                      • qtwidgets-module.html
                      • qtwidgets-painting-affine-affine-pro.html
                      • qtwidgets-painting-affine-affine-qrc.html
                      • qtwidgets-painting-affine-example.html
                      • qtwidgets-painting-affine-main-cpp.html
                      • qtwidgets-painting-affine-xform-cpp.html
                      • qtwidgets-painting-affine-xform-h.html
                      • qtwidgets-painting-basicdrawing-basicdrawing-pro.html
                      • qtwidgets-painting-basicdrawing-basicdrawing-qrc.html
                      • qtwidgets-painting-basicdrawing-example.html
                      • qtwidgets-painting-basicdrawing-main-cpp.html
                      • qtwidgets-painting-basicdrawing-renderarea-cpp.html
                      • qtwidgets-painting-basicdrawing-renderarea-h.html
                      • qtwidgets-painting-basicdrawing-window-cpp.html
                      • qtwidgets-painting-basicdrawing-window-h.html
                      • qtwidgets-painting-composition-composition-cpp.html
                      • qtwidgets-painting-composition-composition-h.html
                      • qtwidgets-painting-composition-composition-pro.html
                      • qtwidgets-painting-composition-composition-qrc.html
                      • qtwidgets-painting-composition-example.html
                      • qtwidgets-painting-composition-main-cpp.html
                      • qtwidgets-painting-concentriccircles-circlewidget-cpp.html
                      • qtwidgets-painting-concentriccircles-circlewidget-h.html
                      • qtwidgets-painting-concentriccircles-concentriccircles-pro.html
                      • qtwidgets-painting-concentriccircles-example.html
                      • qtwidgets-painting-concentriccircles-main-cpp.html
                      • qtwidgets-painting-concentriccircles-window-cpp.html
                      • qtwidgets-painting-concentriccircles-window-h.html
                      • qtwidgets-painting-deform-deform-pro.html
                      • qtwidgets-painting-deform-deform-qrc.html
                      • qtwidgets-painting-deform-example.html
                      • qtwidgets-painting-deform-main-cpp.html
                      • qtwidgets-painting-deform-pathdeform-cpp.html
                      • qtwidgets-painting-deform-pathdeform-h.html
                      • qtwidgets-painting-fontsampler-example.html
                      • qtwidgets-painting-fontsampler-fontsampler-pro.html
                      • qtwidgets-painting-fontsampler-main-cpp.html
                      • qtwidgets-painting-fontsampler-mainwindow-cpp.html
                      • qtwidgets-painting-fontsampler-mainwindow-h.html
                      • qtwidgets-painting-fontsampler-mainwindowbase-ui.html
                      • qtwidgets-painting-gradients-example.html
                      • qtwidgets-painting-gradients-gradients-cpp.html
                      • qtwidgets-painting-gradients-gradients-h.html
                      • qtwidgets-painting-gradients-gradients-pro.html
                      • qtwidgets-painting-gradients-gradients-qrc.html
                      • qtwidgets-painting-gradients-main-cpp.html
                      • qtwidgets-painting-imagecomposition-example.html
                      • qtwidgets-painting-imagecomposition-imagecomposer-cpp.html
                      • qtwidgets-painting-imagecomposition-imagecomposer-h.html
                      • qtwidgets-painting-imagecomposition-imagecomposition-pro.html
                      • qtwidgets-painting-imagecomposition-imagecomposition-qrc.html
                      • qtwidgets-painting-imagecomposition-main-cpp.html
                      • qtwidgets-painting-painterpaths-example.html
                      • qtwidgets-painting-painterpaths-main-cpp.html
                      • qtwidgets-painting-painterpaths-painterpaths-pro.html
                      • qtwidgets-painting-painterpaths-renderarea-cpp.html
                      • qtwidgets-painting-painterpaths-renderarea-h.html
                      • qtwidgets-painting-painterpaths-window-cpp.html
                      • qtwidgets-painting-painterpaths-window-h.html
                      • qtwidgets-painting-pathstroke-example.html
                      • qtwidgets-painting-pathstroke-main-cpp.html
                      • qtwidgets-painting-pathstroke-pathstroke-cpp.html
                      • qtwidgets-painting-pathstroke-pathstroke-h.html
                      • qtwidgets-painting-pathstroke-pathstroke-pro.html
                      • qtwidgets-painting-pathstroke-pathstroke-qrc.html
                      • qtwidgets-painting-transformations-example.html
                      • qtwidgets-painting-transformations-main-cpp.html
                      • qtwidgets-painting-transformations-renderarea-cpp.html
                      • qtwidgets-painting-transformations-renderarea-h.html
                      • qtwidgets-painting-transformations-transformations-pro.html
                      • qtwidgets-painting-transformations-window-cpp.html
                      • qtwidgets-painting-transformations-window-h.html
                      • qtwidgets-richtext-calendar-calendar-pro.html
                      • qtwidgets-richtext-calendar-example.html
                      • qtwidgets-richtext-calendar-main-cpp.html
                      • qtwidgets-richtext-calendar-mainwindow-cpp.html
                      • qtwidgets-richtext-calendar-mainwindow-h.html
                      • qtwidgets-richtext-orderform-detailsdialog-cpp.html
                      • qtwidgets-richtext-orderform-detailsdialog-h.html
                      • qtwidgets-richtext-orderform-example.html
                      • qtwidgets-richtext-orderform-main-cpp.html
                      • qtwidgets-richtext-orderform-mainwindow-cpp.html
                      • qtwidgets-richtext-orderform-mainwindow-h.html
                      • qtwidgets-richtext-orderform-orderform-pro.html
                      • qtwidgets-richtext-syntaxhighlighter-example.html
                      • qtwidgets-richtext-syntaxhighlighter-highlighter-cpp.html
                      • qtwidgets-richtext-syntaxhighlighter-highlighter-h.html
                      • qtwidgets-richtext-syntaxhighlighter-main-cpp.html
                      • qtwidgets-richtext-syntaxhighlighter-mainwindow-cpp.html
                      • qtwidgets-richtext-syntaxhighlighter-mainwindow-h.html
                      • qtwidgets-richtext-syntaxhighlighter-syntaxhighlighter-pro.html
                      • qtwidgets-richtext-textedit-example.html
                      • qtwidgets-richtext-textedit-main-cpp.html
                      • qtwidgets-richtext-textedit-textedit-cpp.html
                      • qtwidgets-richtext-textedit-textedit-h.html
                      • qtwidgets-richtext-textedit-textedit-pro.html
                      • qtwidgets-richtext-textedit-textedit-qrc.html
                      • qtwidgets-statemachine-eventtransitions-eventtransitions-pro.html
                      • qtwidgets-statemachine-eventtransitions-example.html
                      • qtwidgets-statemachine-eventtransitions-main-cpp.html
                      • qtwidgets-statemachine-factorial-example.html
                      • qtwidgets-statemachine-factorial-factorial-pro.html
                      • qtwidgets-statemachine-factorial-main-cpp.html
                      • qtwidgets-statemachine-pingpong-example.html
                      • qtwidgets-statemachine-pingpong-main-cpp.html
                      • qtwidgets-statemachine-pingpong-pingpong-pro.html
                      • qtwidgets-statemachine-rogue-example.html
                      • qtwidgets-statemachine-rogue-main-cpp.html
                      • qtwidgets-statemachine-rogue-movementtransition-h.html
                      • qtwidgets-statemachine-rogue-rogue-pro.html
                      • qtwidgets-statemachine-rogue-window-cpp.html
                      • qtwidgets-statemachine-rogue-window-h.html
                      • qtwidgets-statemachine-trafficlight-example.html
                      • qtwidgets-statemachine-trafficlight-main-cpp.html
                      • qtwidgets-statemachine-trafficlight-trafficlight-pro.html
                      • qtwidgets-statemachine-twowaybutton-example.html
                      • qtwidgets-statemachine-twowaybutton-main-cpp.html
                      • qtwidgets-statemachine-twowaybutton-twowaybutton-pro.html
                      • qtwidgets-tools-codecs-codecs-pro.html
                      • qtwidgets-tools-codecs-example.html
                      • qtwidgets-tools-codecs-main-cpp.html
                      • qtwidgets-tools-codecs-mainwindow-cpp.html
                      • qtwidgets-tools-codecs-mainwindow-h.html
                      • qtwidgets-tools-codecs-previewform-cpp.html
                      • qtwidgets-tools-codecs-previewform-h.html
                      • qtwidgets-tools-completer-completer-pro.html
                      • qtwidgets-tools-completer-completer-qrc.html
                      • qtwidgets-tools-completer-example.html
                      • qtwidgets-tools-completer-fsmodel-cpp.html
                      • qtwidgets-tools-completer-fsmodel-h.html
                      • qtwidgets-tools-completer-main-cpp.html
                      • qtwidgets-tools-completer-mainwindow-cpp.html
                      • qtwidgets-tools-completer-mainwindow-h.html
                      • qtwidgets-tools-customcompleter-customcompleter-pro.html
                      • qtwidgets-tools-customcompleter-customcompleter-qrc.html
                      • qtwidgets-tools-customcompleter-example.html
                      • qtwidgets-tools-customcompleter-main-cpp.html
                      • qtwidgets-tools-customcompleter-mainwindow-cpp.html
                      • qtwidgets-tools-customcompleter-mainwindow-h.html
                      • qtwidgets-tools-customcompleter-textedit-cpp.html
                      • qtwidgets-tools-customcompleter-textedit-h.html
                      • qtwidgets-tools-echoplugin-echoplugin-pro.html
                      • qtwidgets-tools-echoplugin-echowindow-echointerface-h.html
                      • qtwidgets-tools-echoplugin-echowindow-echowindow-cpp.html
                      • qtwidgets-tools-echoplugin-echowindow-echowindow-h.html
                      • qtwidgets-tools-echoplugin-echowindow-echowindow-pro.html
                      • qtwidgets-tools-echoplugin-echowindow-main-cpp.html
                      • qtwidgets-tools-echoplugin-example.html
                      • qtwidgets-tools-echoplugin-plugin-echoplugin-cpp.html
                      • qtwidgets-tools-echoplugin-plugin-echoplugin-h.html
                      • qtwidgets-tools-echoplugin-plugin-plugin-pro.html
                      • qtwidgets-tools-i18n-example.html
                      • qtwidgets-tools-i18n-i18n-pro.html
                      • qtwidgets-tools-i18n-i18n-qrc.html
                      • qtwidgets-tools-i18n-languagechooser-cpp.html
                      • qtwidgets-tools-i18n-languagechooser-h.html
                      • qtwidgets-tools-i18n-main-cpp.html
                      • qtwidgets-tools-i18n-mainwindow-cpp.html
                      • qtwidgets-tools-i18n-mainwindow-h.html
                      • qtwidgets-tools-plugandpaint-app-app-pro.html
                      • qtwidgets-tools-plugandpaint-app-example.html
                      • qtwidgets-tools-plugandpaint-app-interfaces-h.html
                      • qtwidgets-tools-plugandpaint-app-main-cpp.html
                      • qtwidgets-tools-plugandpaint-app-mainwindow-cpp.html
                      • qtwidgets-tools-plugandpaint-app-mainwindow-h.html
                      • qtwidgets-tools-plugandpaint-app-paintarea-cpp.html
                      • qtwidgets-tools-plugandpaint-app-paintarea-h.html
                      • qtwidgets-tools-plugandpaint-app-plugindialog-cpp.html
                      • qtwidgets-tools-plugandpaint-app-plugindialog-h.html
                      • qtwidgets-tools-plugandpaint-plugins-basictools-basictools-pro.html
                      • qtwidgets-tools-plugandpaint-plugins-basictools-basictoolsplugin-cpp.html
                      • qtwidgets-tools-plugandpaint-plugins-basictools-basictoolsplugin-h.html
                      • qtwidgets-tools-plugandpaint-plugins-basictools-example.html
                      • qtwidgets-tools-plugandpaint-plugins-extrafilters-example.html
                      • qtwidgets-tools-plugandpaint-plugins-extrafilters-extrafilters-pro.html
                      • qtwidgets-tools-plugandpaint-plugins-extrafilters-extrafiltersplugin-cpp.html
                      • qtwidgets-tools-plugandpaint-plugins-extrafilters-extrafiltersplugin-h.html
                      • qtwidgets-tools-regexp-example.html
                      • qtwidgets-tools-regexp-main-cpp.html
                      • qtwidgets-tools-regexp-regexp-pro.html
                      • qtwidgets-tools-regexp-regexpdialog-cpp.html
                      • qtwidgets-tools-regexp-regexpdialog-h.html
                      • qtwidgets-tools-regularexpression-example.html
                      • qtwidgets-tools-regularexpression-main-cpp.html
                      • qtwidgets-tools-regularexpression-regularexpression-pro.html
                      • qtwidgets-tools-regularexpression-regularexpression-qrc.html
                      • qtwidgets-tools-regularexpression-regularexpressiondialog-cpp.html
                      • qtwidgets-tools-regularexpression-regularexpressiondialog-h.html
                      • qtwidgets-tools-settingseditor-example.html
                      • qtwidgets-tools-settingseditor-locationdialog-cpp.html
                      • qtwidgets-tools-settingseditor-locationdialog-h.html
                      • qtwidgets-tools-settingseditor-main-cpp.html
                      • qtwidgets-tools-settingseditor-mainwindow-cpp.html
                      • qtwidgets-tools-settingseditor-mainwindow-h.html
                      • qtwidgets-tools-settingseditor-settingseditor-pro.html
                      • qtwidgets-tools-settingseditor-settingstree-cpp.html
                      • qtwidgets-tools-settingseditor-settingstree-h.html
                      • qtwidgets-tools-settingseditor-variantdelegate-cpp.html
                      • qtwidgets-tools-settingseditor-variantdelegate-h.html
                      • qtwidgets-tools-styleplugin-example.html
                      • qtwidgets-tools-styleplugin-plugin-plugin-pro.html
                      • qtwidgets-tools-styleplugin-plugin-simplestyle-cpp.html
                      • qtwidgets-tools-styleplugin-plugin-simplestyle-h.html
                      • qtwidgets-tools-styleplugin-plugin-simplestyleplugin-cpp.html
                      • qtwidgets-tools-styleplugin-plugin-simplestyleplugin-h.html
                      • qtwidgets-tools-styleplugin-styleplugin-pro.html
                      • qtwidgets-tools-styleplugin-stylewindow-main-cpp.html
                      • qtwidgets-tools-styleplugin-stylewindow-stylewindow-cpp.html
                      • qtwidgets-tools-styleplugin-stylewindow-stylewindow-h.html
                      • qtwidgets-tools-styleplugin-stylewindow-stylewindow-pro.html
                      • qtwidgets-tools-treemodelcompleter-example.html
                      • qtwidgets-tools-treemodelcompleter-main-cpp.html
                      • qtwidgets-tools-treemodelcompleter-mainwindow-cpp.html
                      • qtwidgets-tools-treemodelcompleter-mainwindow-h.html
                      • qtwidgets-tools-treemodelcompleter-treemodelcompleter-cpp.html
                      • qtwidgets-tools-treemodelcompleter-treemodelcompleter-h.html
                      • qtwidgets-tools-treemodelcompleter-treemodelcompleter-pro.html
                      • qtwidgets-tools-treemodelcompleter-treemodelcompleter-qrc.html
                      • qtwidgets-tools-undo-commands-cpp.html
                      • qtwidgets-tools-undo-commands-h.html
                      • qtwidgets-tools-undo-document-cpp.html
                      • qtwidgets-tools-undo-document-h.html
                      • qtwidgets-tools-undo-example.html
                      • qtwidgets-tools-undo-main-cpp.html
                      • qtwidgets-tools-undo-mainwindow-cpp.html
                      • qtwidgets-tools-undo-mainwindow-h.html
                      • qtwidgets-tools-undo-mainwindow-ui.html
                      • qtwidgets-tools-undo-undo-pro.html
                      • qtwidgets-tools-undo-undo-qrc.html
                      • qtwidgets-tools-undoframework-commands-cpp.html
                      • qtwidgets-tools-undoframework-commands-h.html
                      • qtwidgets-tools-undoframework-diagramitem-cpp.html
                      • qtwidgets-tools-undoframework-diagramitem-h.html
                      • qtwidgets-tools-undoframework-diagramscene-cpp.html
                      • qtwidgets-tools-undoframework-diagramscene-h.html
                      • qtwidgets-tools-undoframework-example.html
                      • qtwidgets-tools-undoframework-main-cpp.html
                      • qtwidgets-tools-undoframework-mainwindow-cpp.html
                      • qtwidgets-tools-undoframework-mainwindow-h.html
                      • qtwidgets-tools-undoframework-undoframework-pro.html
                      • qtwidgets-tools-undoframework-undoframework-qrc.html
                      • qtwidgets-tutorials-addressbook-part1-addressbook-cpp.html
                      • qtwidgets-tutorials-addressbook-part1-addressbook-h.html
                      • qtwidgets-tutorials-addressbook-part1-example.html
                      • qtwidgets-tutorials-addressbook-part1-main-cpp.html
                      • qtwidgets-tutorials-addressbook-part1-part1-pro.html
                      • qtwidgets-tutorials-addressbook-part2-addressbook-cpp.html
                      • qtwidgets-tutorials-addressbook-part2-addressbook-h.html
                      • qtwidgets-tutorials-addressbook-part2-example.html
                      • qtwidgets-tutorials-addressbook-part2-main-cpp.html
                      • qtwidgets-tutorials-addressbook-part2-part2-pro.html
                      • qtwidgets-tutorials-addressbook-part3-addressbook-cpp.html
                      • qtwidgets-tutorials-addressbook-part3-addressbook-h.html
                      • qtwidgets-tutorials-addressbook-part3-example.html
                      • qtwidgets-tutorials-addressbook-part3-main-cpp.html
                      • qtwidgets-tutorials-addressbook-part3-part3-pro.html
                      • qtwidgets-tutorials-addressbook-part4-addressbook-cpp.html
                      • qtwidgets-tutorials-addressbook-part4-addressbook-h.html
                      • qtwidgets-tutorials-addressbook-part4-example.html
                      • qtwidgets-tutorials-addressbook-part4-main-cpp.html
                      • qtwidgets-tutorials-addressbook-part4-part4-pro.html
                      • qtwidgets-tutorials-addressbook-part5-addressbook-cpp.html
                      • qtwidgets-tutorials-addressbook-part5-addressbook-h.html
                      • qtwidgets-tutorials-addressbook-part5-example.html
                      • qtwidgets-tutorials-addressbook-part5-finddialog-cpp.html
                      • qtwidgets-tutorials-addressbook-part5-finddialog-h.html
                      • qtwidgets-tutorials-addressbook-part5-main-cpp.html
                      • qtwidgets-tutorials-addressbook-part5-part5-pro.html
                      • qtwidgets-tutorials-addressbook-part6-addressbook-cpp.html
                      • qtwidgets-tutorials-addressbook-part6-addressbook-h.html
                      • qtwidgets-tutorials-addressbook-part6-example.html
                      • qtwidgets-tutorials-addressbook-part6-finddialog-cpp.html
                      • qtwidgets-tutorials-addressbook-part6-finddialog-h.html
                      • qtwidgets-tutorials-addressbook-part6-main-cpp.html
                      • qtwidgets-tutorials-addressbook-part6-part6-pro.html
                      • qtwidgets-tutorials-addressbook-part7-addressbook-cpp.html
                      • qtwidgets-tutorials-addressbook-part7-addressbook-h.html
                      • qtwidgets-tutorials-addressbook-part7-example.html
                      • qtwidgets-tutorials-addressbook-part7-finddialog-cpp.html
                      • qtwidgets-tutorials-addressbook-part7-finddialog-h.html
                      • qtwidgets-tutorials-addressbook-part7-main-cpp.html
                      • qtwidgets-tutorials-addressbook-part7-part7-pro.html
                      • qtwidgets-tutorials-widgets-childwidget-childwidget-pro.html
                      • qtwidgets-tutorials-widgets-childwidget-example.html
                      • qtwidgets-tutorials-widgets-childwidget-main-cpp.html
                      • qtwidgets-tutorials-widgets-nestedlayouts-example.html
                      • qtwidgets-tutorials-widgets-nestedlayouts-main-cpp.html
                      • qtwidgets-tutorials-widgets-nestedlayouts-nestedlayouts-pro.html
                      • qtwidgets-tutorials-widgets-toplevel-example.html
                      • qtwidgets-tutorials-widgets-toplevel-main-cpp.html
                      • qtwidgets-tutorials-widgets-toplevel-toplevel-pro.html
                      • qtwidgets-tutorials-widgets-windowlayout-example.html
                      • qtwidgets-tutorials-widgets-windowlayout-main-cpp.html
                      • qtwidgets-tutorials-widgets-windowlayout-windowlayout-pro.html
                      • qtwidgets-widgets-analogclock-analogclock-cpp.html
                      • qtwidgets-widgets-analogclock-analogclock-h.html
                      • qtwidgets-widgets-analogclock-analogclock-pro.html
                      • qtwidgets-widgets-analogclock-example.html
                      • qtwidgets-widgets-analogclock-main-cpp.html
                      • qtwidgets-widgets-calculator-button-cpp.html
                      • qtwidgets-widgets-calculator-button-h.html
                      • qtwidgets-widgets-calculator-calculator-cpp.html
                      • qtwidgets-widgets-calculator-calculator-h.html
                      • qtwidgets-widgets-calculator-calculator-pro.html
                      • qtwidgets-widgets-calculator-example.html
                      • qtwidgets-widgets-calculator-main-cpp.html
                      • qtwidgets-widgets-calendarwidget-calendarwidget-pro.html
                      • qtwidgets-widgets-calendarwidget-example.html
                      • qtwidgets-widgets-calendarwidget-main-cpp.html
                      • qtwidgets-widgets-calendarwidget-window-cpp.html
                      • qtwidgets-widgets-calendarwidget-window-h.html
                      • qtwidgets-widgets-charactermap-charactermap-pro.html
                      • qtwidgets-widgets-charactermap-characterwidget-cpp.html
                      • qtwidgets-widgets-charactermap-characterwidget-h.html
                      • qtwidgets-widgets-charactermap-example.html
                      • qtwidgets-widgets-charactermap-main-cpp.html
                      • qtwidgets-widgets-charactermap-mainwindow-cpp.html
                      • qtwidgets-widgets-charactermap-mainwindow-h.html
                      • qtwidgets-widgets-codeeditor-codeeditor-cpp.html
                      • qtwidgets-widgets-codeeditor-codeeditor-h.html
                      • qtwidgets-widgets-codeeditor-codeeditor-pro.html
                      • qtwidgets-widgets-codeeditor-example.html
                      • qtwidgets-widgets-codeeditor-main-cpp.html
                      • qtwidgets-widgets-digitalclock-digitalclock-cpp.html
                      • qtwidgets-widgets-digitalclock-digitalclock-h.html
                      • qtwidgets-widgets-digitalclock-digitalclock-pro.html
                      • qtwidgets-widgets-digitalclock-example.html
                      • qtwidgets-widgets-digitalclock-main-cpp.html
                      • qtwidgets-widgets-elidedlabel-elidedlabel-cpp.html
                      • qtwidgets-widgets-elidedlabel-elidedlabel-h.html
                      • qtwidgets-widgets-elidedlabel-elidedlabel-pro.html
                      • qtwidgets-widgets-elidedlabel-example.html
                      • qtwidgets-widgets-elidedlabel-main-cpp.html
                      • qtwidgets-widgets-elidedlabel-testwidget-cpp.html
                      • qtwidgets-widgets-elidedlabel-testwidget-h.html
                      • qtwidgets-widgets-groupbox-example.html
                      • qtwidgets-widgets-groupbox-groupbox-pro.html
                      • qtwidgets-widgets-groupbox-main-cpp.html
                      • qtwidgets-widgets-groupbox-window-cpp.html
                      • qtwidgets-widgets-groupbox-window-h.html
                      • qtwidgets-widgets-icons-example.html
                      • qtwidgets-widgets-icons-iconpreviewarea-cpp.html
                      • qtwidgets-widgets-icons-iconpreviewarea-h.html
                      • qtwidgets-widgets-icons-icons-pro.html
                      • qtwidgets-widgets-icons-iconsizespinbox-cpp.html
                      • qtwidgets-widgets-icons-iconsizespinbox-h.html
                      • qtwidgets-widgets-icons-imagedelegate-cpp.html
                      • qtwidgets-widgets-icons-imagedelegate-h.html
                      • qtwidgets-widgets-icons-main-cpp.html
                      • qtwidgets-widgets-icons-mainwindow-cpp.html
                      • qtwidgets-widgets-icons-mainwindow-h.html
                      • qtwidgets-widgets-imageviewer-example.html
                      • qtwidgets-widgets-imageviewer-imageviewer-cpp.html
                      • qtwidgets-widgets-imageviewer-imageviewer-h.html
                      • qtwidgets-widgets-imageviewer-imageviewer-pro.html
                      • qtwidgets-widgets-imageviewer-main-cpp.html
                      • qtwidgets-widgets-lineedits-example.html
                      • qtwidgets-widgets-lineedits-lineedits-pro.html
                      • qtwidgets-widgets-lineedits-main-cpp.html
                      • qtwidgets-widgets-lineedits-window-cpp.html
                      • qtwidgets-widgets-lineedits-window-h.html
                      • qtwidgets-widgets-mousebuttons-buttontester-cpp.html
                      • qtwidgets-widgets-mousebuttons-buttontester-h.html
                      • qtwidgets-widgets-mousebuttons-example.html
                      • qtwidgets-widgets-mousebuttons-main-cpp.html
                      • qtwidgets-widgets-mousebuttons-mousebuttons-pro.html
                      • qtwidgets-widgets-movie-example.html
                      • qtwidgets-widgets-movie-main-cpp.html
                      • qtwidgets-widgets-movie-movie-pro.html
                      • qtwidgets-widgets-movie-movieplayer-cpp.html
                      • qtwidgets-widgets-movie-movieplayer-h.html
                      • qtwidgets-widgets-scribble-example.html
                      • qtwidgets-widgets-scribble-main-cpp.html
                      • qtwidgets-widgets-scribble-mainwindow-cpp.html
                      • qtwidgets-widgets-scribble-mainwindow-h.html
                      • qtwidgets-widgets-scribble-scribble-pro.html
                      • qtwidgets-widgets-scribble-scribblearea-cpp.html
                      • qtwidgets-widgets-scribble-scribblearea-h.html
                      • qtwidgets-widgets-shapedclock-example.html
                      • qtwidgets-widgets-shapedclock-main-cpp.html
                      • qtwidgets-widgets-shapedclock-shapedclock-cpp.html
                      • qtwidgets-widgets-shapedclock-shapedclock-h.html
                      • qtwidgets-widgets-shapedclock-shapedclock-pro.html
                      • qtwidgets-widgets-sliders-example.html
                      • qtwidgets-widgets-sliders-main-cpp.html
                      • qtwidgets-widgets-sliders-sliders-pro.html
                      • qtwidgets-widgets-sliders-slidersgroup-cpp.html
                      • qtwidgets-widgets-sliders-slidersgroup-h.html
                      • qtwidgets-widgets-sliders-window-cpp.html
                      • qtwidgets-widgets-sliders-window-h.html
                      • qtwidgets-widgets-spinboxes-example.html
                      • qtwidgets-widgets-spinboxes-main-cpp.html
                      • qtwidgets-widgets-spinboxes-spinboxes-pro.html
                      • qtwidgets-widgets-spinboxes-window-cpp.html
                      • qtwidgets-widgets-spinboxes-window-h.html
                      • qtwidgets-widgets-styles-example.html
                      • qtwidgets-widgets-styles-main-cpp.html
                      • qtwidgets-widgets-styles-norwegianwoodstyle-cpp.html
                      • qtwidgets-widgets-styles-norwegianwoodstyle-h.html
                      • qtwidgets-widgets-styles-styles-pro.html
                      • qtwidgets-widgets-styles-styles-qrc.html
                      • qtwidgets-widgets-styles-widgetgallery-cpp.html
                      • qtwidgets-widgets-styles-widgetgallery-h.html
                      • qtwidgets-widgets-stylesheet-example.html
                      • qtwidgets-widgets-stylesheet-layouts-default-ui.html
                      • qtwidgets-widgets-stylesheet-layouts-pagefold-ui.html
                      • qtwidgets-widgets-stylesheet-main-cpp.html
                      • qtwidgets-widgets-stylesheet-mainwindow-cpp.html
                      • qtwidgets-widgets-stylesheet-mainwindow-h.html
                      • qtwidgets-widgets-stylesheet-mainwindow-ui.html
                      • qtwidgets-widgets-stylesheet-stylesheet-pro.html
                      • qtwidgets-widgets-stylesheet-stylesheet-qrc.html
                      • qtwidgets-widgets-stylesheet-stylesheeteditor-cpp.html
                      • qtwidgets-widgets-stylesheet-stylesheeteditor-h.html
                      • qtwidgets-widgets-stylesheet-stylesheeteditor-ui.html
                      • qtwidgets-widgets-tablet-example.html
                      • qtwidgets-widgets-tablet-images-qrc.html
                      • qtwidgets-widgets-tablet-main-cpp.html
                      • qtwidgets-widgets-tablet-mainwindow-cpp.html
                      • qtwidgets-widgets-tablet-mainwindow-h.html
                      • qtwidgets-widgets-tablet-tablet-pro.html
                      • qtwidgets-widgets-tablet-tabletapplication-cpp.html
                      • qtwidgets-widgets-tablet-tabletapplication-h.html
                      • qtwidgets-widgets-tablet-tabletcanvas-cpp.html
                      • qtwidgets-widgets-tablet-tabletcanvas-h.html
                      • qtwidgets-widgets-tetrix-example.html
                      • qtwidgets-widgets-tetrix-main-cpp.html
                      • qtwidgets-widgets-tetrix-tetrix-pro.html
                      • qtwidgets-widgets-tetrix-tetrixboard-cpp.html
                      • qtwidgets-widgets-tetrix-tetrixboard-h.html
                      • qtwidgets-widgets-tetrix-tetrixpiece-cpp.html
                      • qtwidgets-widgets-tetrix-tetrixpiece-h.html
                      • qtwidgets-widgets-tetrix-tetrixwindow-cpp.html
                      • qtwidgets-widgets-tetrix-tetrixwindow-h.html
                      • qtwidgets-widgets-tooltips-example.html
                      • qtwidgets-widgets-tooltips-main-cpp.html
                      • qtwidgets-widgets-tooltips-shapeitem-cpp.html
                      • qtwidgets-widgets-tooltips-shapeitem-h.html
                      • qtwidgets-widgets-tooltips-sortingbox-cpp.html
                      • qtwidgets-widgets-tooltips-sortingbox-h.html
                      • qtwidgets-widgets-tooltips-tooltips-pro.html
                      • qtwidgets-widgets-tooltips-tooltips-qrc.html
                      • qtwidgets-widgets-validators-example.html
                      • qtwidgets-widgets-validators-ledwidget-cpp.html
                      • qtwidgets-widgets-validators-ledwidget-h.html
                      • qtwidgets-widgets-validators-localeselector-cpp.html
                      • qtwidgets-widgets-validators-localeselector-h.html
                      • qtwidgets-widgets-validators-main-cpp.html
                      • qtwidgets-widgets-validators-validators-pro.html
                      • qtwidgets-widgets-validators-validators-qrc.html
                      • qtwidgets-widgets-validators-validators-ui.html
                      • qtwidgets-widgets-wiggly-dialog-cpp.html
                      • qtwidgets-widgets-wiggly-dialog-h.html
                      • qtwidgets-widgets-wiggly-example.html
                      • qtwidgets-widgets-wiggly-main-cpp.html
                      • qtwidgets-widgets-wiggly-wiggly-pro.html
                      • qtwidgets-widgets-wiggly-wigglywidget-cpp.html
                      • qtwidgets-widgets-wiggly-wigglywidget-h.html
                      • qtwidgets-widgets-windowflags-controllerwindow-cpp.html
                      • qtwidgets-widgets-windowflags-controllerwindow-h.html
                      • qtwidgets-widgets-windowflags-example.html
                      • qtwidgets-widgets-windowflags-main-cpp.html
                      • qtwidgets-widgets-windowflags-previewwindow-cpp.html
                      • qtwidgets-widgets-windowflags-previewwindow-h.html
                      • qtwidgets-widgets-windowflags-windowflags-pro.html
                      • qtwidgets.index
                      • qtwidgets.qhp
                      • qtwidgets.qhp.sha1
                      • qtwidgets.tags
                      • qundocommand-members.html
                      • qundocommand.html
                      • qundogroup-members.html
                      • qundogroup.html
                      • qundostack-members.html
                      • qundostack.html
                      • qundoview-members.html
                      • qundoview.html
                      • qvboxlayout-members.html
                      • qvboxlayout.html
                      • qwhatsthis-members.html
                      • qwhatsthis.html
                      • qwidget-members.html
                      • qwidget-obsolete.html
                      • qwidget-styling.html
                      • qwidget.html
                      • qwidgetaction-members.html
                      • qwidgetaction.html
                      • qwidgetitem-members.html
                      • qwidgetitem.html
                      • qwizard-members.html
                      • qwizard.html
                      • qwizardpage-members.html
                      • qwizardpage.html
                      • standard-dialogs.html
                      • style-reference.html
                      • style
                        • offline-simple.css
                        • offline.css
                      • stylesheet-customizing.html
                      • stylesheet-designer.html
                      • stylesheet-examples.html
                      • stylesheet-reference.html
                      • stylesheet-syntax.html
                      • stylesheet.html
                      • textedit-example.html
                      • tutorials-addressbook.html
                      • widget-classes.html
                      • widgets-tutorial.html
                    • qtwinextras.qch
                    • qtwinextras
                      • examples-manifest.xml
                      • examples-qtwinextras.html
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • glass.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • jumplist.png
                        • logo.png
                        • peek-on.png
                        • qtwinextras-musicplayer-composited.png
                        • qtwinextras-musicplayer-non-composited.png
                        • qtwinextras-musicplayer-taskbar.png
                        • qtwinextras-musicplayer-thumbnail.png
                        • qtwinextras-quickplayer-composited.png
                        • qtwinextras-quickplayer-non-composited.png
                        • qtwinextras-quickplayer-taskbar.png
                        • qtwinextras-quickplayer-thumbnail.png
                        • taskbar-button.png
                        • taskbar-progress-indeterminate.png
                        • taskbar-progress-paused.png
                        • taskbar-progress-stopped.png
                        • taskbar-progress.png
                        • thumbbar.png
                        • used-in-examples
                          • quickplayer
                            • images
                              • media-pause-16.png
                              • media-pause-32.png
                              • media-play-16.png
                              • media-play-32.png
                              • media-seek-backward-32.png
                              • media-seek-forward-32.png
                              • media-stop-32.png
                      • qml-qtwinextras-dwmfeatures-members.html
                      • qml-qtwinextras-dwmfeatures.html
                      • qml-qtwinextras-jumplist-members.html
                      • qml-qtwinextras-jumplist.html
                      • qml-qtwinextras-jumplistcategory-members.html
                      • qml-qtwinextras-jumplistcategory.html
                      • qml-qtwinextras-jumplistdestination-members.html
                      • qml-qtwinextras-jumplistdestination.html
                      • qml-qtwinextras-jumplistlink-members.html
                      • qml-qtwinextras-jumplistlink.html
                      • qml-qtwinextras-jumplistseparator-members.html
                      • qml-qtwinextras-jumplistseparator.html
                      • qml-qtwinextras-taskbarbutton-members.html
                      • qml-qtwinextras-taskbarbutton.html
                      • qml-qtwinextras-thumbnailtoolbar-members.html
                      • qml-qtwinextras-thumbnailtoolbar.html
                      • qml-qtwinextras-thumbnailtoolbutton-members.html
                      • qml-qtwinextras-thumbnailtoolbutton.html
                      • qtwin.html
                      • qtwinextras-iconextractor-example.html
                      • qtwinextras-iconextractor-iconextractor-pro.html
                      • qtwinextras-iconextractor-main-cpp.html
                      • qtwinextras-index.html
                      • qtwinextras-module.html
                      • qtwinextras-musicplayer-example.html
                      • qtwinextras-musicplayer-main-cpp.html
                      • qtwinextras-musicplayer-musicplayer-cpp.html
                      • qtwinextras-musicplayer-musicplayer-h.html
                      • qtwinextras-musicplayer-musicplayer-pro.html
                      • qtwinextras-musicplayer-volumebutton-cpp.html
                      • qtwinextras-musicplayer-volumebutton-h.html
                      • qtwinextras-overview.html
                      • qtwinextras-qmlmodule.html
                      • qtwinextras-quickplayer-example.html
                      • qtwinextras-quickplayer-main-cpp.html
                      • qtwinextras-quickplayer-qml-main-qml.html
                      • qtwinextras-quickplayer-quickplayer-pro.html
                      • qtwinextras-quickplayer-quickplayer-qrc.html
                      • qtwinextras.index
                      • qtwinextras.qhp
                      • qtwinextras.qhp.sha1
                      • qwinjumplist-members.html
                      • qwinjumplist.html
                      • qwinjumplistcategory-members.html
                      • qwinjumplistcategory.html
                      • qwinjumplistitem-members.html
                      • qwinjumplistitem.html
                      • qwinmime-members.html
                      • qwinmime.html
                      • qwintaskbarbutton-members.html
                      • qwintaskbarbutton.html
                      • qwintaskbarprogress-members.html
                      • qwintaskbarprogress.html
                      • qwinthumbnailtoolbar-members.html
                      • qwinthumbnailtoolbar.html
                      • qwinthumbnailtoolbutton-members.html
                      • qwinthumbnailtoolbutton.html
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtx11extras.qch
                    • qtx11extras
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                      • qtx11extras-index.html
                      • qtx11extras-module.html
                      • qtx11extras.index
                      • qtx11extras.qhp
                      • qtx11extras.qhp.sha1
                      • qx11info-members.html
                      • qx11info.html
                      • style
                        • offline-simple.css
                        • offline.css
                    • qtxml.qch
                    • qtxml
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • dombookmarks-example.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • saxbookmarks-example.png
                        • xmlstreamexample-filemenu.png
                        • xmlstreamexample-helpmenu.png
                        • xmlstreamexample-screenshot.png
                      • qdomattr-members.html
                      • qdomattr.html
                      • qdomcdatasection-members.html
                      • qdomcdatasection.html
                      • qdomcharacterdata-members.html
                      • qdomcharacterdata.html
                      • qdomcomment-members.html
                      • qdomcomment.html
                      • qdomdocument-members.html
                      • qdomdocument.html
                      • qdomdocumentfragment-members.html
                      • qdomdocumentfragment.html
                      • qdomdocumenttype-members.html
                      • qdomdocumenttype.html
                      • qdomelement-members.html
                      • qdomelement.html
                      • qdomentity-members.html
                      • qdomentity.html
                      • qdomentityreference-members.html
                      • qdomentityreference.html
                      • qdomimplementation-members.html
                      • qdomimplementation.html
                      • qdomnamednodemap-members.html
                      • qdomnamednodemap.html
                      • qdomnode-members.html
                      • qdomnode.html
                      • qdomnodelist-members.html
                      • qdomnodelist.html
                      • qdomnotation-members.html
                      • qdomnotation.html
                      • qdomprocessinginstruction-members.html
                      • qdomprocessinginstruction.html
                      • qdomtext-members.html
                      • qdomtext.html
                      • qtxml-dombookmarks-dombookmarks-pro.html
                      • qtxml-dombookmarks-example.html
                      • qtxml-dombookmarks-main-cpp.html
                      • qtxml-dombookmarks-mainwindow-cpp.html
                      • qtxml-dombookmarks-mainwindow-h.html
                      • qtxml-dombookmarks-xbeltree-cpp.html
                      • qtxml-dombookmarks-xbeltree-h.html
                      • qtxml-index.html
                      • qtxml-module.html
                      • qtxml-saxbookmarks-example.html
                      • qtxml-saxbookmarks-main-cpp.html
                      • qtxml-saxbookmarks-mainwindow-cpp.html
                      • qtxml-saxbookmarks-mainwindow-h.html
                      • qtxml-saxbookmarks-saxbookmarks-pro.html
                      • qtxml-saxbookmarks-xbelgenerator-cpp.html
                      • qtxml-saxbookmarks-xbelgenerator-h.html
                      • qtxml-saxbookmarks-xbelhandler-cpp.html
                      • qtxml-saxbookmarks-xbelhandler-h.html
                      • qtxml-streambookmarks-example.html
                      • qtxml-streambookmarks-main-cpp.html
                      • qtxml-streambookmarks-mainwindow-cpp.html
                      • qtxml-streambookmarks-mainwindow-h.html
                      • qtxml-streambookmarks-streambookmarks-pro.html
                      • qtxml-streambookmarks-xbelreader-cpp.html
                      • qtxml-streambookmarks-xbelreader-h.html
                      • qtxml-streambookmarks-xbelwriter-cpp.html
                      • qtxml-streambookmarks-xbelwriter-h.html
                      • qtxml-xmlstreamlint-example.html
                      • qtxml-xmlstreamlint-main-cpp.html
                      • qtxml-xmlstreamlint-xmlstreamlint-pro.html
                      • qtxml.index
                      • qtxml.qhp
                      • qtxml.qhp.sha1
                      • qtxml.tags
                      • qxmlattributes-members.html
                      • qxmlattributes.html
                      • qxmlcontenthandler-members.html
                      • qxmlcontenthandler.html
                      • qxmldeclhandler-members.html
                      • qxmldeclhandler.html
                      • qxmldefaulthandler-members.html
                      • qxmldefaulthandler.html
                      • qxmldtdhandler-members.html
                      • qxmldtdhandler.html
                      • qxmlentityresolver-members.html
                      • qxmlentityresolver.html
                      • qxmlerrorhandler-members.html
                      • qxmlerrorhandler.html
                      • qxmlinputsource-members.html
                      • qxmlinputsource.html
                      • qxmllexicalhandler-members.html
                      • qxmllexicalhandler.html
                      • qxmllocator-members.html
                      • qxmllocator.html
                      • qxmlnamespacesupport-members.html
                      • qxmlnamespacesupport.html
                      • qxmlparseexception-members.html
                      • qxmlparseexception.html
                      • qxmlreader-members.html
                      • qxmlreader-obsolete.html
                      • qxmlreader.html
                      • qxmlsimplereader-members.html
                      • qxmlsimplereader.html
                      • style
                        • offline-simple.css
                        • offline.css
                      • xml-dom-tml.html
                      • xml-namespaces.html
                      • xml-processing.html
                      • xml-sax.html
                      • xml-streaming.html
                      • xml-tools.html
                    • qtxmlpatterns.qch
                    • qtxmlpatterns
                      • examples-manifest.xml
                      • images
                        • arrow_bc.png
                        • bgrContent.png
                        • btn_next.png
                        • btn_prev.png
                        • bullet_dn.png
                        • bullet_sq.png
                        • filetree_1-example.png
                        • filetree_2-example.png
                        • home.png
                        • ico_note.png
                        • ico_note_attention.png
                        • ico_out.png
                        • logo.png
                        • patternist-wordProcessor.png
                        • recipes-example.png
                        • schema-example.png
                      • qabstractmessagehandler-members.html
                      • qabstractmessagehandler.html
                      • qabstracturiresolver-members.html
                      • qabstracturiresolver.html
                      • qabstractxmlnodemodel-members.html
                      • qabstractxmlnodemodel.html
                      • qabstractxmlreceiver-members.html
                      • qabstractxmlreceiver.html
                      • qsimplexmlnodemodel-members.html
                      • qsimplexmlnodemodel.html
                      • qsourcelocation-members.html
                      • qsourcelocation.html
                      • qtxmlpatterns-filetree-example.html
                      • qtxmlpatterns-filetree-filetree-cpp.html
                      • qtxmlpatterns-filetree-filetree-h.html
                      • qtxmlpatterns-filetree-filetree-pro.html
                      • qtxmlpatterns-filetree-forms-mainwindow-ui.html
                      • qtxmlpatterns-filetree-main-cpp.html
                      • qtxmlpatterns-filetree-mainwindow-cpp.html
                      • qtxmlpatterns-filetree-mainwindow-h.html
                      • qtxmlpatterns-filetree-queries-listcppfiles-xq.html
                      • qtxmlpatterns-filetree-queries-qrc.html
                      • qtxmlpatterns-filetree-queries-wholetree-xq.html
                      • qtxmlpatterns-index.html
                      • qtxmlpatterns-module.html
                      • qtxmlpatterns-recipes-example.html
                      • qtxmlpatterns-recipes-files-allrecipes-xq.html
                      • qtxmlpatterns-recipes-files-cookbook-xml.html
                      • qtxmlpatterns-recipes-files-liquidingredientsinsoup-xq.html
                      • qtxmlpatterns-recipes-files-mushroomsoup-xq.html
                      • qtxmlpatterns-recipes-files-preparationlessthan30-xq.html
                      • qtxmlpatterns-recipes-files-preparationtimes-xq.html
                      • qtxmlpatterns-recipes-forms-querywidget-mobiles-ui.html
                      • qtxmlpatterns-recipes-forms-querywidget-ui.html
                      • qtxmlpatterns-recipes-main-cpp.html
                      • qtxmlpatterns-recipes-querymainwindow-cpp.html
                      • qtxmlpatterns-recipes-querymainwindow-h.html
                      • qtxmlpatterns-recipes-recipes-pro.html
                      • qtxmlpatterns-recipes-recipes-qrc.html
                      • qtxmlpatterns-schema-example.html
                      • qtxmlpatterns-schema-files-invalid-contact-xml.html
                      • qtxmlpatterns-schema-files-invalid-order-xml.html
                      • qtxmlpatterns-schema-files-invalid-recipe-xml.html
                      • qtxmlpatterns-schema-files-valid-contact-xml.html
                      • qtxmlpatterns-schema-files-valid-order-xml.html
                      • qtxmlpatterns-schema-files-valid-recipe-xml.html
                      • qtxmlpatterns-schema-main-cpp.html
                      • qtxmlpatterns-schema-mainwindow-cpp.html
                      • qtxmlpatterns-schema-mainwindow-h.html
                      • qtxmlpatterns-schema-schema-mobiles-ui.html
                      • qtxmlpatterns-schema-schema-pro.html
                      • qtxmlpatterns-schema-schema-qrc.html
                      • qtxmlpatterns-schema-schema-ui.html
                      • qtxmlpatterns-xquery-example.html
                      • qtxmlpatterns-xquery-globalvariables-globals-cpp.html
                      • qtxmlpatterns-xquery-globalvariables-reportglobals-xq.html
                      • qtxmlpatterns-xquery-xquery-pro.html
                      • qtxmlpatterns.index
                      • qtxmlpatterns.qhp
                      • qtxmlpatterns.qhp.sha1
                      • qtxmlpatterns.tags
                      • qxmlformatter-members.html
                      • qxmlformatter.html
                      • qxmlitem-members.html
                      • qxmlitem.html
                      • qxmlname-members.html
                      • qxmlname.html
                      • qxmlnamepool-members.html
                      • qxmlnamepool.html
                      • qxmlnodemodelindex-members.html
                      • qxmlnodemodelindex.html
                      • qxmlquery-members.html
                      • qxmlquery.html
                      • qxmlresultitems-members.html
                      • qxmlresultitems.html
                      • qxmlschema-members.html
                      • qxmlschema.html
                      • qxmlschemavalidator-members.html
                      • qxmlschemavalidator.html
                      • qxmlserializer-members.html
                      • qxmlserializer.html
                      • style
                        • offline-simple.css
                        • offline.css
                      • xmlpattern-examples.html
                      • xmlprocessing.html
                      • xquery-introduction.html
                • licenses
                  • qt5-doc